PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Spipo4G0055700

Organism

Spirodela polyrhiza

Taxonomic ID

29656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela

Family

CAMTA

Protein Properties

Length: 109aa MW: 12644.4 Da PI: 9.8688

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Spipo4G0055700	genome	MIPS/IBIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	136.3	1e-42	14	109	4	99
CG-1 4 ekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrc 98 k+rwlk++e+++iL+n+++ ++ e+++rp+ gsl+L+nr+++r+frkDG+ w++kkdg+t+ E+he+LKv++v +l+cyYah+eenp fqrr+ Spipo4G0055700 14 AKSRWLKPSEVLSILINHDENLISPEPPNRPPGGSLFLFNRRVLRFFRKDGHVWRRKKDGRTIGEAHEQLKVENVPALSCYYAHGEENPCFQRRS 108 589*******************************************************************************************9 PP CG-1 99 y 99 y Spipo4G0055700 109 Y 109 9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51437	62.754	7	109	IPR005559	CG-1 DNA-binding domain
SMART	SM01076	1.2E-46	10	109	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	9.2E-39	14	109	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 109 aa Download sequence Send to blast
QIPGFDIGNL YPAAKSRWLK PSEVLSILIN HDENLISPEP PNRPPGGSLF LFNRRVLRFF 60 RKDGHVWRRK KDGRTIGEAH EQLKVENVPA LSCYYAHGEE NPCFQRRSY

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250\|UniProtKB:Q8GSA7, ECO:0000269\|PubMed:23581962, ECO:0000269\|PubMed:25039701, ECO:0000269\|PubMed:25627216, ECO:0000305\|PubMed:11925432}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:25627216}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010239809.1	4e-50	calmodulin-binding transcription activator 4 isoform X1
Swissprot	Q6NPP4	1e-42	CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBL	A0A1D1YWA6	6e-51	A0A1D1YWA6_9ARAE; Calmodulin-binding transcription activator 4
TrEMBL	A0A1D1ZH88	4e-51	A0A1D1ZH88_9ARAE; Calmodulin-binding transcription activator 4 (Fragment)
STRING	BRADI5G08167.1	1e-48	(Brachypodium distachyon)
STRING	AET04958	1e-48	(Medicago truncatula)
STRING	TRIUR3_26386-P1	2e-48	(Triticum urartu)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP15485	8	17

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64220.2	6e-34	Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains

Link Out ? help Back to Top
Phytozome	Spipo4G0055700

Publications ? help Back to Top
Benn G, et al. A key general stress response motif is regulated non-uniformly by CAMTA transcription factors. Plant J., 2014. 80(1): p. 82-92 [PMID:25039701] Kidokoro S, et al. Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. Plant Cell, 2017. 29(4): p. 760-774 [PMID:28351986]