PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo3G0039300 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 183aa MW: 19731.7 Da PI: 5.7624 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 164.6 | 1.3e-51 | 35 | 130 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 +eqdr+lPianv+rimkk+lP nakisk+aket+qecvsefisfvt+easdkc +ekrkt+ngdd++wal+tlGf+dy+ + + yl+kyr ege Spipo3G0039300 35 KEQDRLLPIANVGRIMKKILPPNAKISKEAKETMQECVSEFISFVTGEASDKCLKEKRKTVNGDDICWALGTLGFDDYASATRRYLHKYRGSEGE 129 89******************************************************************************************998 PP NF-YB 97 k 97 + Spipo3G0039300 130 R 130 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.9E-49 | 32 | 145 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.01E-37 | 37 | 157 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.0E-27 | 40 | 104 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.5E-16 | 68 | 86 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 71 | 87 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 6.5E-16 | 87 | 105 | No hit | No description |
PRINTS | PR00615 | 6.5E-16 | 106 | 124 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MGDSRGSSPE ADTRNNNGEG ASGGVAASES DDCIKEQDRL LPIANVGRIM KKILPPNAKI 60 SKEAKETMQE CVSEFISFVT GEASDKCLKE KRKTVNGDDI CWALGTLGFD DYASATRRYL 120 HKYRGSEGER AVAYKGGPAD GGDQELHLFG GDQVRNNQAS TSNSFKFNVV DWNSGHSTTK 180 PY* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 6e-43 | 34 | 124 | 1 | 91 | Transcription factor HapC (Eurofung) |
4g92_B | 6e-43 | 34 | 124 | 1 | 91 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB288038 | 1e-75 | AB288038.1 Oryza sativa Japonica Group OsHAP3D gene for HAP3 subunit of HAP complex, complete cds. | |||
GenBank | AP003246 | 1e-75 | AP003246.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0423A12. | |||
GenBank | AP003266 | 1e-75 | AP003266.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0492G09. | |||
GenBank | AP014957 | 1e-75 | AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence. | |||
GenBank | CP012609 | 1e-75 | CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence. | |||
GenBank | CT836573 | 1e-75 | CT836573.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA128I01, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010259679.1 | 3e-66 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 5e-58 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A1U8A0J5 | 6e-65 | A0A1U8A0J5_NELNU; nuclear transcription factor Y subunit B-5-like | ||||
STRING | XP_010259679.1 | 1e-65 | (Nelumbo nucifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 6e-60 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo3G0039300 |
Publications ? help Back to Top | |||
---|---|---|---|
|