PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo2G0051400 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 89aa MW: 9872.36 Da PI: 7.0102 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 76.6 | 4.3e-24 | 10 | 87 | 3 | 84 |
DUF260 3 aaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 aaCk+l +kC + Cv+ py+p+e+++kf n+ ++FGa+nv k+l+++ + ++da++sl++eA+ dP++G++g i++lq Spipo2G0051400 10 AACKYLHEKCIPCCVFTPYLPQEESAKFMNMYHFFGARNVAKILNHVLPVSHRDAVTSLYFEAD----DPINGCLGYIQALQ 87 8*************************************************************96....***********998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 15.01 | 7 | 88 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.5E-23 | 10 | 88 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MASSSSPAYA ACKYLHEKCI PCCVFTPYLP QEESAKFMNM YHFFGARNVA KILNHVLPVS 60 HRDAVTSLYF EADDPINGCL GYIQALQH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-24 | 10 | 88 | 13 | 95 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-24 | 10 | 88 | 13 | 95 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC254539 | 1e-122 | AC254539.1 Spirodela polyrhiza clone GNAS837-M21, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022004798.1 | 9e-27 | protein LATERAL ORGAN BOUNDARIES-like | ||||
Swissprot | Q9FML4 | 8e-24 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A251VF39 | 2e-25 | A0A251VF39_HELAN; Putative LOB domain-containing protein | ||||
TrEMBL | A0A2N9ITT4 | 4e-25 | A0A2N9ITT4_FAGSY; Uncharacterized protein | ||||
STRING | XP_010029135.1 | 7e-25 | (Eucalyptus grandis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 3e-26 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo2G0051400 |
Publications ? help Back to Top | |||
---|---|---|---|
|