PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim10g080030.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 230aa    MW: 25791.3 Da    PI: 6.3738
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim10g080030.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.27.8e-27959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        k+ien s rqvtfskRr+g++KKAeELSvLCdae+ vi+fs+t++ly ++s
  Sopim10g080030.0.1  9 KKIENISSRQVTFSKRRAGLFKKAEELSVLCDAEIGVIVFSNTDRLYKFAS 59
                        68***********************************************86 PP

2K-box55.23.1e-19881581888
               K-box  18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 
                         + el+ Lk+e+ +L++   +++G++L+ L++keLqqLe+qL +++ ++++kK+++lle +e++  + +el 
  Sopim10g080030.0.1  88 EPELNSLKAEVAKLRKATGRMMGKELDGLDFKELQQLEHQLTEGILSVKNKKEQVLLELLEKSNLQIEELG 158
                         5699******************************************************9999887777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.964161IPR002100Transcription factor, MADS-box
CDDcd002652.87E-39277No hitNo description
SuperFamilySSF554557.59E-30277IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.93584175IPR002487Transcription factor, K-box
PfamPF014862.1E-1387157IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MGRGKIEMKK IENISSRQVT FSKRRAGLFK KAEELSVLCD AEIGVIVFSN TDRLYKFASS  60
KSSMEKIVER YNSSSHSFEH PMIENVVEPE LNSLKAEVAK LRKATGRMMG KELDGLDFKE  120
LQQLEHQLTE GILSVKNKKE QVLLELLEKS NLQIEELGHK SCNHYPENYE AARKISGGNT  180
TVICDFKSVE EENSDTSLSL GLSVATSQKK KNPQIECTSN DSENLMILD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A8e-19189187MEF2C
5f28_B8e-19189187MEF2C
5f28_C8e-19189187MEF2C
5f28_D8e-19189187MEF2C
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755221e-100HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249753.11e-167MADS-box transcription factor 23-like
TrEMBLA0A3Q7JFA21e-165A0A3Q7JFA2_SOLLC; Uncharacterized protein
STRINGSolyc10g080030.1.11e-166(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57390.12e-40AGAMOUS-like 18