PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G57390.1

Common Name

AGL18, F28O9.240

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MIKC_MADS

Protein Properties

Length: 256aa MW: 28874.4 Da PI: 6.0018

Description

AGAMOUS-like 18

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G57390.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	86.3	1.8e-27	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien rqvtfskRrng++KKA+ELS+LCdaeva+iifsstgk+y++ss AT3G57390.1 9 KKIENINSRQVTFSKRRNGLIKKAKELSILCDAEVALIIFSSTGKIYDFSS 59 68***********************************************96 PP
2	K-box	54.7	4.3e-19	97	179	17	99
K-box 17 lqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 ++ + +k e+e Lq + +l+G++Le +s+ +L +Le+qL++sl +++++K+++ll+qie+++ +ek++ een+ Lrk++e AT3G57390.1 97 VLRNDDSMKGELERLQLAIERLKGKELEGMSFPDLISLENQLNESLHSVKDQKTQILLNQIERSRIQEKKALEENQILRKQVE 179 55566899************************************************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	31.833	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.2E-39	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.58E-31	2	83	IPR002100	Transcription factor, MADS-box
CDD	cd00265	9.25E-41	2	75	No hit	No description
PRINTS	PR00404	6.2E-29	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.1E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.2E-29	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.2E-29	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	13.259	94	184	IPR002487	Transcription factor, K-box
Pfam	PF01486	2.2E-16	96	178	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009555	Biological Process	pollen development
GO:0009910	Biological Process	negative regulation of flower development
GO:0048577	Biological Process	negative regulation of short-day photoperiodism, flowering
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000084	anatomy	plant sperm cell
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0009089	anatomy	endosperm
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025195	anatomy	pollen tube cell
PO:0025281	anatomy	pollen
PO:0001016	developmental stage	L mature pollen stage
PO:0001017	developmental stage	M germinated pollen stage
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 256 aa Download sequence Send to blast
MGRGRIEIKK IENINSRQVT FSKRRNGLIK KAKELSILCD AEVALIIFSS TGKIYDFSSV 60 CMEQILSRYG YTTASTEHKQ QREHQLLICA SHGNEAVLRN DDSMKGELER LQLAIERLKG 120 KELEGMSFPD LISLENQLNE SLHSVKDQKT QILLNQIERS RIQEKKALEE NQILRKQVEM 180 LGRGSGPKVL NERPQDSSPE ADPESSSSEE DENDNEEHHS DTSLQLGLSS TGYCTKRKKP 240 KIELVCDNSG SQVASD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	6e-20	1	69	1	69	MEF2C
5f28_B	6e-20	1	69	1	69	MEF2C
5f28_C	6e-20	1	69	1	69	MEF2C
5f28_D	6e-20	1	69	1	69	MEF2C
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.24026	0.0	root\| seed\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	251623_at	0.0
Expression Atlas	AT3G57390	-
AtGenExpress	AT3G57390	-
ATTED-II	AT3G57390	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During the reproductive phase, accumulates in immature buds and at the base of the floral organs, and in the receptacle, ovules, anther filaments, and stigma and style of open flowers. Later observed in sporogenous tissue of anthers. During male gametogenesis, expressed in the microspores before they separate from each other. Later present at high levels within pollen grains up to stage 13 of flower development, when anthers dehisce. During carpel development, first detected in developing ovules. After fertilization, confined to globular structures or nodules of proliferating free nuclear endosperm required for embryo development. Disappears from the endosperm at to the heart stage of embryo development, when very little nuclear endosperm remains. Never detected in developing embryos at any stage. In young seedlings, present everywhere except in a portion of the hypocotyl and in newly emerging leaves. {ECO:0000269\|PubMed:11115127, ECO:0000269\|PubMed:17521410}.
Uniprot	TISSUE SPECIFICITY: Mostly expressed in pollen, roots, flowers and siliques, and to a lower extent, in stems and leaves. Expressed in the endosperm and in developing male and female gametophytes. Also present in seedlings. {ECO:0000269\|PubMed:11115127, ECO:0000269\|PubMed:12837945, ECO:0000269\|PubMed:12949148, ECO:0000269\|PubMed:16028119, ECO:0000269\|PubMed:17521410}.

Functional Description ? help Back to Top
Source	Description
TAIR	encodes a MADS-box containing protein likely to be a transcription factor that is expressed in endosperm and developing gametophytes. The protein sequence is most similar to that of AGL15, which is expressed in developing embryos.
UniProt	Probable transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Prevents premature flowering. Downstream regulator of a subset of the MIKC* MADS-controlled genes required during pollen maturation. {ECO:0000269\|PubMed:17521410, ECO:0000269\|PubMed:18034896, ECO:0000269\|PubMed:18799658}.

Function -- GeneRIF ? help Back to Top
Flowering time is determined by the additive effect of multiple MADS domain floral repressors, with important contributions from AGL15 and AGL18. [PMID: 17521410] AGL15 and AGL18 may form a complex along with other proteins, and bind to the CArG motifs of the promoters of MIR156 to activate the MIR156 expression. [PMID: 25666346]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G57390.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT5G13790 (R)

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G13790

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Altered expression of MIKC* MADS-controlled genes during pollen maturation. Early flowering under short-days conditions (SD) when combined with AGL15 disruption. {ECO:0000269\|PubMed:17521410, ECO:0000269\|PubMed:18034896, ECO:0000269\|PubMed:18799658}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G57390

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF312663	0.0	AF312663.1 Arabidopsis thaliana MADS-box protein AGL18 (AGL18) mRNA, complete cds.
GenBank	AK222220	0.0	AK222220.1 Arabidopsis thaliana mRNA for MADS transcription factor-like protein, complete cds, clone: RAFL25-29-C20.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_191298.1	0.0	AGAMOUS-like 18
Swissprot	Q9M2K8	0.0	AGL18_ARATH; Agamous-like MADS-box protein AGL18
TrEMBL	A0A178VAT6	0.0	A0A178VAT6_ARATH; AGL18
STRING	AT3G57390.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6061	21	39
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT3G57390.1
Entrez Gene	824906
iHOP	AT3G57390
wikigenes	AT3G57390

Publications ? help Back to Top
Alvarez-Buylla ER, et al. MADS-box gene evolution beyond flowers: expression in pollen, endosperm, guard cells, roots and trichomes. Plant J., 2000. 24(4): p. 457-66 [PMID:11115127] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Ma L, et al. Genomic evidence for COP1 as a repressor of light-regulated gene expression and development in Arabidopsis. Plant Cell, 2002. 14(10): p. 2383-98 [PMID:12368493] Zik M,Irish VF Global identification of target genes regulated by APETALA3 and PISTILLATA floral homeotic gene action. Plant Cell, 2003. 15(1): p. 207-22 [PMID:12509532] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] Pina C,Pinto F,Feij Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation. Plant Physiol., 2005. 138(2): p. 744-56 [PMID:15908605] Gan Y,Filleur S,Rahman A,Gotensparre S,Forde BG Nutritional regulation of ANR1 and other root-expressed MADS-box genes in Arabidopsis thaliana. Planta, 2005. 222(4): p. 730-42 [PMID:16021502] Lehti-Shiu MD,Adamczyk BJ,Fernandez DE Expression of MADS-box genes during the embryonic phase in Arabidopsis. Plant Mol. Biol., 2005. 58(1): p. 89-107 [PMID:16028119] He XJ, et al. AtNAC2, a transcription factor downstream of ethylene and auxin signaling pathways, is involved in salt stress response and lateral root development. Plant J., 2005. 44(6): p. 903-16 [PMID:16359384] Truman W,de Zabala MT,Grant M Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance. Plant J., 2006. 46(1): p. 14-33 [PMID:16553893] Helliwell CA,Wood CC,Robertson M,James Peacock W,Dennis ES The Arabidopsis FLC protein interacts directly in vivo with SOC1 and FT chromatin and is part of a high-molecular-weight protein complex. Plant J., 2006. 46(2): p. 183-92 [PMID:16623882] Kim J,Shiu SH,Thoma S,Li WH,Patterson SE Patterns of expansion and expression divergence in the plant polygalacturonase gene family. Genome Biol., 2006. 7(9): p. R87 [PMID:17010199] Verelst W,Saedler H,Münster T MIKC* MADS-protein complexes bind motifs enriched in the proximal region of late pollen-specific Arabidopsis promoters. Plant Physiol., 2007. 143(1): p. 447-60 [PMID:17071640] Adamczyk BJ,Lehti-Shiu MD,Fernandez DE The MADS domain factors AGL15 and AGL18 act redundantly as repressors of the floral transition in Arabidopsis. Plant J., 2007. 50(6): p. 1007-19 [PMID:17521410] Hill K,Wang H,Perry SE A transcriptional repression motif in the MADS factor AGL15 is involved in recruitment of histone deacetylase complex components. Plant J., 2008. 53(1): p. 172-85 [PMID:17999645] Verelst W, et al. MADS-complexes regulate transcriptome dynamics during pollen maturation. Genome Biol., 2007. 8(11): p. R249 [PMID:18034896] Thakare D,Tang W,Hill K,Perry SE The MADS-domain transcriptional regulator AGAMOUS-LIKE15 promotes somatic embryo development in Arabidopsis and soybean. Plant Physiol., 2008. 146(4): p. 1663-72 [PMID:18305206] Wang Y, et al. Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] Pouteau S, et al. Diversification of photoperiodic response patterns in a collection of early-flowering mutants of Arabidopsis. Plant Physiol., 2008. 148(3): p. 1465-73 [PMID:18799658] Reňák D,Dupl'áková N,Honys D Wide-scale screening of T-DNA lines for transcription factor genes affecting male gametophyte development in Arabidopsis. Sex. Plant Reprod., 2012. 25(1): p. 39-60 [PMID:22101548] Gu X,Wang Y,He Y Photoperiodic regulation of flowering time through periodic histone deacetylation of the florigen gene FT. PLoS Biol., 2013. 11(9): p. e1001649 [PMID:24019760] Fernandez DE, et al. The MADS-Domain Factors AGAMOUS-LIKE15 and AGAMOUS-LIKE18, along with SHORT VEGETATIVE PHASE and AGAMOUS-LIKE24, Are Necessary to Block Floral Gene Expression during the Vegetative Phase. Plant Physiol., 2014. 165(4): p. 1591-1603 [PMID:24948837] Serivichyaswat P, et al. Expression of the floral repressor miRNA156 is positively regulated by the AGAMOUS-like proteins AGL15 and AGL18. Mol. Cells, 2015. 38(3): p. 259-66 [PMID:25666346] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178]