PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g069430.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 246aa    MW: 28290 Da    PI: 9.5681
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g069430.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.31.1e-29958150
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        krienk+nrqvtfskRr g+lKKA+E+SvLCdaev +i+fs++gkl+ey+
  Sopim06g069430.0.1  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYA 58
                        79***********************************************8 PP

2K-box106.14.2e-35831749100
               K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                         ++++   s++ e+akLk+++e Lqr+q+h++GedLesLs+keLq+Le+qL+++lk+iRs+Kn+l++e+i+ lqkk ++lqe+n++L+kk++
  Sopim06g069430.0.1  83 TDHTSPVSWTLEHAKLKARLEVLQRNQKHYVGEDLESLSMKELQNLEHQLDSALKHIRSRKNQLMHESISVLQKKDRALQEQNNQLSKKVK 173
                         56667789*********************************************************************************98 PP

               K-box 100 e 100
                         e
  Sopim06g069430.0.1 174 E 174
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.001161IPR002100Transcription factor, MADS-box
CDDcd002655.14E-41274No hitNo description
SuperFamilySSF554551.96E-33291IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-31323IPR002100Transcription factor, MADS-box
PfamPF003196.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-313859IPR002100Transcription factor, MADS-box
PfamPF014866.9E-2988172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.52388178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVGLIVFST KGKLFEYAND  60
SCMERILERY ERYSFAEKQL VPTDHTSPVS WTLEHAKLKA RLEVLQRNQK HYVGEDLESL  120
SMKELQNLEH QLDSALKHIR SRKNQLMHES ISVLQKKDRA LQEQNNQLSK KVKEREKEVA  180
QQNQWEINSS SFVLPQQLDS PHLGEAYQST NVIDNGEVEG GSSSQQQGAA NNTVMPQWML  240
RHLNN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q5e-22174173Myocyte-specific enhancer factor 2B
1tqe_R5e-22174173Myocyte-specific enhancer factor 2B
1tqe_S5e-22174173Myocyte-specific enhancer factor 2B
6byy_A5e-22174173MEF2 CHIMERA
6byy_B5e-22174173MEF2 CHIMERA
6byy_C5e-22174173MEF2 CHIMERA
6byy_D5e-22174173MEF2 CHIMERA
6c9l_A5e-22174173Myocyte-specific enhancer factor 2B
6c9l_B5e-22174173Myocyte-specific enhancer factor 2B
6c9l_C5e-22174173Myocyte-specific enhancer factor 2B
6c9l_D5e-22174173Myocyte-specific enhancer factor 2B
6c9l_E5e-22174173Myocyte-specific enhancer factor 2B
6c9l_F5e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0132240.0BT013224.1 Lycopersicon esculentum clone 134464F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234173.20.0agamous-like MADS-box protein AGL8 homolog
RefseqXP_019069686.10.0agamous-like MADS-box protein AGL8 homolog isoform X1
RefseqXP_025887092.10.0agamous-like MADS-box protein AGL8 homolog isoform X1
SwissprotQ424291e-174AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLA0A3Q7GYA00.0A0A3Q7GYA0_SOLLC; Uncharacterized protein
STRINGSolyc06g069430.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4992397
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.11e-106AGAMOUS-like 8
Publications ? help Back to Top
  1. Kang SG,Hannapel DJ
    Nucleotide sequences of novel potato (Solanum tuberosum L.) MADS-box cDNAs and their expression in vegetative organs.
    Gene, 1995. 166(2): p. 329-30
    [PMID:8543185]