PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G60910.1

Common Name

AGL8, FUL, MSL3.3

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MIKC_MADS

Protein Properties

Length: 242aa MW: 27536.4 Da PI: 9.8581

Description

AGAMOUS-like 8

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G60910.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	97.6	5.2e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fss+gkl+eys+ AT5G60910.1 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYST 59 79***********************************************96 PP
2	K-box	104	1.8e-34	78	174	4	100
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 ++ + + +++e++ e+akLk+++e L++++R+++GedL+sLslkeLq+Le+qL+ ++k+iRs+Kn+ ++e+i+ lqkk k+lq++n++L kk++e AT5G60910.1 78 KQLVGRDVSQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKELQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNSLLKKIKE 174 56666778899***********************************************************************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	8.5E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.688	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.05E-40	2	79	No hit	No description
SuperFamily	SSF55455	2.09E-33	2	91	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-31	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.1E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-31	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	1.4E-28	86	172	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	15.769	88	178	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009911	Biological Process	positive regulation of flower development
GO:0010077	Biological Process	maintenance of inflorescence meristem identity
GO:0010154	Biological Process	fruit development
GO:0030154	Biological Process	cell differentiation
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000014	anatomy	rosette leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0005022	anatomy	ovary wall
PO:0008019	anatomy	leaf lamina base
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020038	anatomy	petiole
PO:0020148	anatomy	shoot apical meristem
PO:0025022	anatomy	collective leaf structure
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 242 aa Download sequence Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFSS KGKLFEYSTD 60 SCMERILERY DRYLYSDKQL VGRDVSQSEN WVLEHAKLKA RVEVLEKNKR NFMGEDLDSL 120 SLKELQSLEH QLDAAIKSIR SRKNQAMFES ISALQKKDKA LQDHNNSLLK KIKEREKKTG 180 QQEGQLVQCS NSSSVLLPQY CVTSSRDGFV ERVGGENGGA SSLTEPNSLL PAWMLRPTTT 240 NE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	4e-22	1	73	1	72	MEF2C
5f28_B	4e-22	1	73	1	72	MEF2C
5f28_C	4e-22	1	73	1	72	MEF2C
5f28_D	4e-22	1	73	1	72	MEF2C
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.5426	0.0	floral meristem\| flower\| leaf\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	145359505	0.0
Genevisible	247553_at	0.0
Expression Atlas	AT5G60910	-
AtGenExpress	AT5G60910	-
ATTED-II	AT5G60910	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Vascular tissue of cauline leaves, floral shoot apex and valves of carpels and fruits. {ECO:0000269\|PubMed:9502732}.

Functional Description ? help Back to Top
Source	Description
TAIR	MADS box gene negatively regulated by APETALA1
UniProt	Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1 and CAULIFLOWER. Is required subsequently for the transition of an inflorescence meristem into a floral meristem (PubMed:28586421). Seems to be partially redundant to the function of APETALA1 and CAULIFLOWER in the up-regulation of LEAFY. Is also required for normal pattern of cell division, expansion and differentiation during morphogenesis of the silique (PubMed:28586421). Probably not required for fruit elongation but instead is required to prevent ectopic activity of IND. Represses SAUR10 expression in stems and inflorescence branches (PubMed:28586421). {ECO:0000269\|PubMed:10648231, ECO:0000269\|PubMed:15035986, ECO:0000269\|PubMed:28586421, ECO:0000269\|PubMed:9502732}.

Function -- GeneRIF ? help Back to Top
Data show that LEAFY, FRUITFULL, and APETALA1 are directly activated by the microRNA-targeted transcription factor SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 3 (SPL3) to control the timing of flower formation. [PMID: 19686687] Two cis-elements were involved in the repression of FUL expression. The first intron of FUL was shown to participate in the development of carpel and stamen as an enhancer. [PMID: 21284215] Flowering is controlled by AGL24 partly independently of SOC1 and FUL. [PMID: 22902690] The sequential formation of FUL-SVP and FUL-SOC1 heterodimers may mediate the vegetative and meristem identity transitions, counteracting the repressive effect of FLC and SVP on flowering. [PMID: 24465009] SAUR10 is repressed by FUL in stems and inflorescence branches. SAUR10 is specifically expressed at the abaxial side of these branches and this localized activity is influenced by hormones, light conditions and by FUL, which has an effect on branch angle. [PMID: 28586421] Data show that FRUITFULL (FUL), a MADS-box gene involved in flowering and fruit development, has a key role in promoting meristem arrest, directly and negatively regulates APETALA2 expression in the shoot apical meristem. [PMID: 29422669]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G60910.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Dramatically up-regulated upon the transition from vegetative to reproductive development.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G69120 (R), AT2G33810 (A), AT2G45190 (A), AT4G00180 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT2G42830(R), AT3G58780(R), AT4G00120(R), AT5G61850(A), AT5G67110(R)

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G60910, AT1G24260, AT1G69120
IntAct	Search Q38876

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G60910

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF386929	0.0	AF386929.1 Arabidopsis thaliana floral homeotic protein AGL8 (MSL3.3) mRNA, complete cds.
GenBank	ATU33473	0.0	U33473.1 Arabidopsis thaliana agamous-like 8 (AGL8) mRNA, complete cds.
GenBank	AY072463	0.0	AY072463.1 Arabidopsis thaliana floral homeotic protein AGL8 (MSL3.3) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_568929.1	1e-179	AGAMOUS-like 8
Swissprot	Q38876	1e-180	AGL8_ARATH; Agamous-like MADS-box protein AGL8
TrEMBL	A0A178UM96	1e-177	A0A178UM96_ARATH; FUL
STRING	AT5G60910.1	1e-178	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM792	25	110
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT5G60910.1
Entrez Gene	836212
iHOP	AT5G60910
wikigenes	AT5G60910

Publications ? help Back to Top
Bowman JL,Baum SF,Eshed Y,Putterill J,Alvarez J Molecular genetics of gynoecium development in Arabidopsis. Curr. Top. Dev. Biol., 1999. 45: p. 155-205 [PMID:10332605] Ferrándiz C,Gu Q,Martienssen R,Yanofsky MF Redundant regulation of meristem identity and plant architecture by FRUITFULL, APETALA1 and CAULIFLOWER. Development, 2000. 127(4): p. 725-34 [PMID:10648231] Chen C,Wang S,Huang H LEUNIG has multiple functions in gynoecium development in Arabidopsis. Genesis, 2000. 26(1): p. 42-54 [PMID:10660672] Ferr Negative regulation of the SHATTERPROOF genes by FRUITFULL during Arabidopsis fruit development. Science, 2000. 289(5478): p. 436-8 [PMID:10903201] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Elo A,Lemmetyinen J,Turunen ML,Tikka L,Sopanen T Three MADS-box genes similar to APETALA1 and FRUITFULL from silver birch (Betula pendula). Physiol Plant, 2001. 112(1): p. 95-103 [PMID:11319020] Vivian-Smith A,Luo M,Chaudhury A,Koltunow A Fruit development is actively restricted in the absence of fertilization in Arabidopsis. Development, 2001. 128(12): p. 2321-31 [PMID:11493551] M The MADS-box gene DEFH28 from Antirrhinum is involved in the regulation of floral meristem identity and fruit development. Plant J., 2001. 28(2): p. 169-79 [PMID:11722760] Rajani S,Sundaresan V The Arabidopsis myc/bHLH gene ALCATRAZ enables cell separation in fruit dehiscence. Curr. Biol., 2001. 11(24): p. 1914-22 [PMID:11747817] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Wen J,Lease KA,Walker JC DVL, a novel class of small polypeptides: overexpression alters Arabidopsis development. Plant J., 2004. 37(5): p. 668-77 [PMID:14871303] Liljegren SJ, et al. Control of fruit patterning in Arabidopsis by INDEHISCENT. Cell, 2004. 116(6): p. 843-53 [PMID:15035986] Fornara F, et al. Functional characterization of OsMADS18, a member of the AP1/SQUA subfamily of MADS box genes. Plant Physiol., 2004. 135(4): p. 2207-19 [PMID:15299121] Espinosa-Soto C,Padilla-Longoria P,Alvarez-Buylla ER A gene regulatory network model for cell-fate determination during Arabidopsis thaliana flower development that is robust and recovers experimental gene expression profiles. Plant Cell, 2004. 16(11): p. 2923-39 [PMID:15486106] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Robles P,Pelaz S Flower and fruit development in Arabidopsis thaliana. Int. J. Dev. Biol., 2005. 49(5-6): p. 633-43 [PMID:16096970] Teper-Bamnolker P,Samach A The flowering integrator FT regulates SEPALLATA3 and FRUITFULL accumulation in Arabidopsis leaves. Plant Cell, 2005. 17(10): p. 2661-75 [PMID:16155177] Dinneny JR,Weigel D,Yanofsky MF A genetic framework for fruit patterning in Arabidopsis thaliana. Development, 2005. 132(21): p. 4687-96 [PMID:16192305] Sundström JF,Nakayama N,Glimelius K,Irish VF Direct regulation of the floral homeotic APETALA1 gene by APETALA3 and PISTILLATA in Arabidopsis. Plant J., 2006. 46(4): p. 593-600 [PMID:16640596] Balanz Patterning the female side of Arabidopsis: the importance of hormones. J. Exp. Bot., 2006. 57(13): p. 3457-69 [PMID:17023565] Pod shatter-resistant Brassica fruit produced by ectopic expression of the FRUITFULL gene. Plant Biotechnol. J., 2006. 4(1): p. 45-51 [PMID:17177784] Tani E,Polidoros AN,Tsaftaris AS Characterization and expression analysis of FRUITFULL- and SHATTERPROOF-like genes from peach (Prunus persica) and their role in split-pit formation. Tree Physiol., 2007. 27(5): p. 649-59 [PMID:17267356] Popescu SC, et al. Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5 [PMID:17360592] Alonso-Cantabrana H, et al. Common regulatory networks in leaf and fruit patterning revealed by mutations in the Arabidopsis ASYMMETRIC LEAVES1 gene. Development, 2007. 134(14): p. 2663-71 [PMID:17592013] Smykal P,Gennen J,De Bodt S,Ranganath V,Melzer S Flowering of strict photoperiodic Nicotiana varieties in non-inductive conditions by transgenic approaches. Plant Mol. Biol., 2007. 65(3): p. 233-42 [PMID:17660946] Preston JC,Kellogg EA Conservation and divergence of APETALA1/FRUITFULL-like gene function in grasses: evidence from gene expression analyses. Plant J., 2007. 52(1): p. 69-81 [PMID:17666026] de Folter S,Urbanus SL,van Zuijlen LG,Kaufmann K,Angenent GC Tagging of MADS domain proteins for chromatin immunoprecipitation. BMC Plant Biol., 2007. 7: p. 47 [PMID:17868439] Leseberg CH, et al. Interaction study of MADS-domain proteins in tomato. J. Exp. Bot., 2008. 59(8): p. 2253-65 [PMID:18487636] Mitsuda N,Ohme-Takagi M NAC transcription factors NST1 and NST3 regulate pod shattering in a partially redundant manner by promoting secondary wall formation after the establishment of tissue identity. Plant J., 2008. 56(5): p. 768-78 [PMID:18657234] Melzer S, et al. Flowering-time genes modulate meristem determinacy and growth form in Arabidopsis thaliana. Nat. Genet., 2008. 40(12): p. 1489-92 [PMID:18997783] Sather DN,Golenberg EM Duplication of AP1 within the Spinacia oleracea L. AP1/FUL clade is followed by rapid amino acid and regulatory evolution. Planta, 2009. 229(3): p. 507-21 [PMID:19005675] Mummenhoff K,Polster A,M Lepidium as a model system for studying the evolution of fruit development in Brassicaceae. J. Exp. Bot., 2009. 60(5): p. 1503-13 [PMID:19052256] Urbanus SL, et al. In planta localisation patterns of MADS domain proteins during floral development in Arabidopsis thaliana. BMC Plant Biol., 2009. 9: p. 5 [PMID:19138429] Girin T,Sorefan K,Ostergaard L Meristematic sculpting in fruit development. J. Exp. Bot., 2009. 60(5): p. 1493-502 [PMID:19246597] D'Aloia M, et al. Gene activation cascade triggered by a single photoperiodic cycle inducing flowering in Sinapis alba. Plant J., 2009. 59(6): p. 962-73 [PMID:19473326] Mitsuda N,Ohme-Takagi M Functional analysis of transcription factors in Arabidopsis. Plant Cell Physiol., 2009. 50(7): p. 1232-48 [PMID:19478073] Yamaguchi A, et al. The microRNA-regulated SBP-Box transcription factor SPL3 is a direct upstream activator of LEAFY, FRUITFULL, and APETALA1. Dev. Cell, 2009. 17(2): p. 268-78 [PMID:19686687] Shikata M,Koyama T,Mitsuda N,Ohme-Takagi M Arabidopsis SBP-box genes SPL10, SPL11 and SPL2 control morphological change in association with shoot maturation in the reproductive phase. Plant Cell Physiol., 2009. 50(12): p. 2133-45 [PMID:19880401] Preston JC,Hileman LC SQUAMOSA-PROMOTER BINDING PROTEIN 1 initiates flowering in Antirrhinum majus through the activation of meristem identity genes. Plant J., 2010. 62(4): p. 704-12 [PMID:20202170] Irish VF The flowering of Arabidopsis flower development. Plant J., 2010. 61(6): p. 1014-28 [PMID:20409275] Ruokolainen S, et al. Characterization of SQUAMOSA-like genes in Gerbera hybrida, including one involved in reproductive transition. BMC Plant Biol., 2010. 10: p. 128 [PMID:20579337] Xu M, et al. Arabidopsis BLADE-ON-PETIOLE1 and 2 promote floral meristem fate and determinacy in a previously undefined pathway targeting APETALA1 and AGAMOUS-LIKE24. Plant J., 2010. 63(6): p. 974-89 [PMID:20626659] Chu T,Xie H,Xu Y,Ma R [Regulation pattern of the FRUITFULL (FUL) gene of Arabidopsis thaliana]. Sheng Wu Gong Cheng Xue Bao, 2010. 26(11): p. 1546-54 [PMID:21284215] Li Y, et al. A cotton gene encoding novel MADS-box protein is preferentially expressed in fibers and functions in cell elongation. Acta Biochim. Biophys. Sin. (Shanghai), 2011. 43(8): p. 607-17 [PMID:21733855] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Groszmann M,Paicu T,Alvarez JP,Swain SM,Smyth DR SPATULA and ALCATRAZ, are partially redundant, functionally diverging bHLH genes required for Arabidopsis gynoecium and fruit development. Plant J., 2011. 68(5): p. 816-29 [PMID:21801252] Ripoll JJ,Roeder AH,Ditta GS,Yanofsky MF A novel role for the floral homeotic gene APETALA2 during Arabidopsis fruit development. Development, 2011. 138(23): p. 5167-76 [PMID:22031547] Nakano T, et al. MACROCALYX and JOINTLESS interact in the transcriptional regulation of tomato fruit abscission zone development. Plant Physiol., 2012. 158(1): p. 439-50 [PMID:22106095] Smaczniak C, et al. Characterization of MADS-domain transcription factor complexes in Arabidopsis flower development. Proc. Natl. Acad. Sci. U.S.A., 2012. 109(5): p. 1560-5 [PMID:22238427] Imura Y, et al. CRYPTIC PRECOCIOUS/MED12 is a novel flowering regulator with multiple target steps in Arabidopsis. Plant Cell Physiol., 2012. 53(2): p. 287-303 [PMID:22247249] Kinjo H,Shitsukawa N,Takumi S,Murai K Diversification of three APETALA1/FRUITFULL-like genes in wheat. Mol. Genet. Genomics, 2012. 287(4): p. 283-94 [PMID:22314801] Torti S, et al. Analysis of the Arabidopsis shoot meristem transcriptome during floral transition identifies distinct regulatory patterns and a leucine-rich repeat protein that promotes flowering. Plant Cell, 2012. 24(2): p. 444-62 [PMID:22319055] Kim JJ, et al. The microRNA156-SQUAMOSA PROMOTER BINDING PROTEIN-LIKE3 module regulates ambient temperature-responsive flowering via FLOWERING LOCUS T in Arabidopsis. Plant Physiol., 2012. 159(1): p. 461-78 [PMID:22427344] Li G, et al. Imitation Switch chromatin remodeling factors and their interacting RINGLET proteins act together in controlling the plant vegetative phase in Arabidopsis. Plant J., 2012. 72(2): p. 261-70 [PMID:22694359] Torti S,Fornara F AGL24 acts in concert with SOC1 and FUL during Arabidopsis floral transition. Plant Signal Behav, 2012. 7(10): p. 1251-4 [PMID:22902690] Avino M,Kramer EM,Donohue K,Hammel AJ,Hall JC Understanding the basis of a novel fruit type in Brassicaceae: conservation and deviation in expression patterns of six genes. Evodevo, 2012. 3(1): p. 20 [PMID:22943452] Bemer M, et al. The tomato FRUITFULL homologs TDR4/FUL1 and MBP7/FUL2 regulate ethylene-independent aspects of fruit ripening. Plant Cell, 2012. 24(11): p. 4437-51 [PMID:23136376] M Evidence that an evolutionary transition from dehiscent to indehiscent fruits in Lepidium (Brassicaceae) was caused by a change in the control of valve margin identity genes. Plant J., 2013. 73(5): p. 824-35 [PMID:23173897] Chung KS,Lee JH,Lee JS,Ahn JH Fruit indehiscence caused by enhanced expression of NO TRANSMITTING TRACT in Arabidopsis thaliana. Mol. Cells, 2013. 35(6): p. 519-25 [PMID:23515580] Yu Y, et al. MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering. Plant Sci., 2013. 212: p. 1-9 [PMID:24094048] Balanz Sequential action of FRUITFULL as a modulator of the activity of the floral regulators SVP and SOC1. J. Exp. Bot., 2014. 65(4): p. 1193-203 [PMID:24465009] Pabón-Mora N,Wong GK,Ambrose BA Evolution of fruit development genes in flowering plants. Front Plant Sci, 2014. 5: p. 300 [PMID:25018763] Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons. GM Crops Food, 2014. 5(4): p. 302-20 [PMID:25523176] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Wang C,Dehesh K From retrograde signaling to flowering time. Plant Signal Behav, 2015. 10(6): p. e1022012 [PMID:26098376] Borghi M,Xie DY Tissue-specific production of limonene in Camelina sativa with the Arabidopsis promoters of genes BANYULS and FRUITFULL. Planta, 2016. 243(2): p. 549-61 [PMID:26530959] Yu Y, et al. WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana. Plant J., 2016. 85(1): p. 96-106 [PMID:26643131] McCarthy EW,Mohamed A,Litt A Functional Divergence of APETALA1 and FRUITFULL is due to Changes in both Regulation and Coding Sequence. Front Plant Sci, 2015. 6: p. 1076 [PMID:26697035] Davin N, et al. Functional network analysis of genes differentially expressed during xylogenesis in soc1ful woody Arabidopsis plants. Plant J., 2016. 86(5): p. 376-90 [PMID:26952251] Hyun Y, et al. Multi-layered Regulation of SPL15 and Cooperation with SOC1 Integrate Endogenous Flowering Pathways at the Arabidopsis Shoot Meristem. Dev. Cell, 2016. 37(3): p. 254-66 [PMID:27134142] José Ripoll J, et al. microRNA regulation of fruit growth. Nat Plants, 2015. 1(4): p. 15036 [PMID:27247036] Li W,Wang H,Yu D Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions. Mol Plant, 2016. 9(11): p. 1492-1503 [PMID:27592586] Eldridge T, et al. Fruit shape diversity in the Brassicaceae is generated by varying patterns of anisotropy. Development, 2016. 143(18): p. 3394-406 [PMID:27624834] Bemer M, et al. FRUITFULL controls SAUR10 expression and regulates Arabidopsis growth and architecture. J. Exp. Bot., 2017. 68(13): p. 3391-3403 [PMID:28586421] Sehra B,Franks RG Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development. Front Plant Sci, 2017. 8: p. 1712 [PMID:29085379] Balanzà V, et al. Genetic control of meristem arrest and life span in Arabidopsis by a FRUITFULL-APETALA2 pathway. Nat Commun, 2018. 9(1): p. 565 [PMID:29422669] Mandel MA,Yanofsky MF The Arabidopsis AGL8 MADS box gene is expressed in inflorescence meristems and is negatively regulated by APETALA1. Plant Cell, 1995. 7(11): p. 1763-71 [PMID:8535133] Gu Q,Ferrándiz C,Yanofsky MF,Martienssen R The FRUITFULL MADS-box gene mediates cell differentiation during Arabidopsis fruit development. Development, 1998. 125(8): p. 1509-17 [PMID:9502732]