PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim03g019710.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 178aa    MW: 20703.9 Da    PI: 10.4362
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim03g019710.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF916.1e-29959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien++nrqvtfskRrng+lKKA+ELS+LCdaeva+++fs++gk y ++s
  Sopim03g019710.0.1  9 KRIENQTNRQVTFSKRRNGLLKKAYELSILCDAEVALLLFSPSGKAYHFAS 59
                        79**********************************************986 PP

2K-box584e-2081157985
               K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 
                         +  + +e ++++++ + + i++L+   +h+ Ge+L++L +keL+qLe+qL  ++++iRskK+++l+e+  +lqk+ k
  Sopim03g019710.0.1  81 QGPRAMEVWRTKIDDMTRTIHELEARDKHFAGEELSNLGMKELKQLERQLRVGVERIRSKKHKILHEENIHLQKQVK 157
                         55567899*****************9***********************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.1E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.604161IPR002100Transcription factor, MADS-box
CDDcd002651.96E-40278No hitNo description
SuperFamilySSF554558.11E-32280IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-31323IPR002100Transcription factor, MADS-box
PfamPF003193.3E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-313859IPR002100Transcription factor, MADS-box
PfamPF014867.3E-1685160IPR002487Transcription factor, K-box
PROSITE profilePS5129710.14986177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MGRGKVELKR IENQTNRQVT FSKRRNGLLK KAYELSILCD AEVALLLFSP SGKAYHFASH  60
DIERTILRYK NEVGLSKNSD QGPRAMEVWR TKIDDMTRTI HELEARDKHF AGEELSNLGM  120
KELKQLERQL RVGVERIRSK KHKILHEENI HLQKQVKLYE VEGSSRILDT NPRMRII*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-23169169Myocyte-specific enhancer factor 2B
1tqe_Q1e-23169169Myocyte-specific enhancer factor 2B
1tqe_R1e-23169169Myocyte-specific enhancer factor 2B
1tqe_S1e-23169169Myocyte-specific enhancer factor 2B
6c9l_A1e-23169169Myocyte-specific enhancer factor 2B
6c9l_B1e-23169169Myocyte-specific enhancer factor 2B
6c9l_C1e-23169169Myocyte-specific enhancer factor 2B
6c9l_D1e-23169169Myocyte-specific enhancer factor 2B
6c9l_E1e-23169169Myocyte-specific enhancer factor 2B
6c9l_F1e-23169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in seed development. {ECO:0000269|PubMed:29853599}.
UniProtProbable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX607600.0X60760.1 L.esculentum TDR8 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010317531.11e-124MADS-box transcription factor TDR8 isoform X1
SwissprotA0A217EJJ02e-47AG11S_VITVI; Agamous-like MADS-box protein AGL11
SwissprotF6I4572e-47AG11C_VITVI; Agamous-like MADS-box protein AGL11
TrEMBLA0A3Q7FGU81e-119A0A3Q7FGU8_SOLLC; Uncharacterized protein
STRINGSolyc03g019710.2.11e-127(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.25e-48MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Mejía N, et al.
    Molecular, genetic and transcriptional evidence for a role of VvAGL11 in stenospermocarpic seedlessness in grapevine.
    BMC Plant Biol., 2011. 11: p. 57
    [PMID:21447172]
  4. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]
  5. Malabarba J, et al.
    The MADS-box gene Agamous-like 11 is essential for seed morphogenesis in grapevine.
    J. Exp. Bot., 2017. 68(7): p. 1493-1506
    [PMID:28369525]
  6. Royo C, et al.
    The Major Origin of Seedless Grapes Is Associated with a Missense Mutation in the MADS-Box Gene VviAGL11.
    Plant Physiol., 2018. 177(3): p. 1234-1253
    [PMID:29853599]