PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G42830.2

Common Name

AGL5, F7D19.17, SHP2

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MIKC_MADS

Protein Properties

Length: 248aa MW: 28384 Da PI: 9.7849

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G42830.2	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	97.6	5.1e-31	24	73	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey+ AT2G42830.2 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYA 73 79***********************************************8 PP
2	K-box	105.5	6.7e-35	97	190	9	100
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqk..kekelqeenkaLrkklee 100 +ea+++++qqe++kL+++i+ +q+ +Rh+lGe+L+sL++keL++Le++Lek+++++RskK+e+l+++ie++qk ke elq++n++Lr+k+ e AT2G42830.2 97 ITEANTQYYQQEASKLRRQIRDIQNLNRHILGESLGSLNFKELKNLESRLEKGISRVRSKKHEMLVAEIEYMQKrvKEIELQNDNMYLRSKITE 190 7899*******************************************************************94457789999****9975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	9.1E-40	16	75	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.389	16	76	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.16E-43	17	90	No hit	No description
SuperFamily	SSF55455	2.09E-32	17	88	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	18	72	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-32	18	38	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.3E-26	25	72	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-32	38	53	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-32	53	74	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	1.3E-24	100	188	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	15.04	102	194	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0048481	Biological Process	plant ovule development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000037	anatomy	shoot apex
PO:0000084	anatomy	plant sperm cell
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009052	anatomy	flower pedicel
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0001380	developmental stage	sepals enclosing flower bud stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 248 aa Download sequence Send to blast
MEGGASNEVA ESSKKIGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL 60 VIFSTRGRLY EYANNSVRGT IERYKKACSD AVNPPTITEA NTQYYQQEAS KLRRQIRDIQ 120 NLNRHILGES LGSLNFKELK NLESRLEKGI SRVRSKKHEM LVAEIEYMQK RVKEIELQND 180 NMYLRSKITE RTGLQQQESS VIHQGTVYES GVTSSHQSGQ YNRNYIAVNL LEPNQNSSNQ 240 DQPPLQLV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1egw_A	5e-20	17	84	1	68	MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_B	5e-20	17	84	1	68	MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_C	5e-20	17	84	1	68	MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_D	5e-20	17	84	1	68	MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1tqe_P	5e-20	16	84	1	69	Myocyte-specific enhancer factor 2B
1tqe_Q	5e-20	16	84	1	69	Myocyte-specific enhancer factor 2B
1tqe_R	5e-20	16	84	1	69	Myocyte-specific enhancer factor 2B
1tqe_S	5e-20	16	84	1	69	Myocyte-specific enhancer factor 2B
5f28_A	5e-20	16	84	1	69	MEF2C
5f28_B	5e-20	16	84	1	69	MEF2C
5f28_C	5e-20	16	84	1	69	MEF2C
5f28_D	5e-20	16	84	1	69	MEF2C
6c9l_A	5e-20	16	84	1	69	Myocyte-specific enhancer factor 2B
6c9l_B	5e-20	16	84	1	69	Myocyte-specific enhancer factor 2B
6c9l_C	5e-20	16	84	1	69	Myocyte-specific enhancer factor 2B
6c9l_D	5e-20	16	84	1	69	Myocyte-specific enhancer factor 2B
6c9l_E	5e-20	16	84	1	69	Myocyte-specific enhancer factor 2B
6c9l_F	5e-20	16	84	1	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.284	0.0	flower\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	263988_at	0.0
Expression Atlas	AT2G42830	-
AtGenExpress	AT2G42830	-
ATTED-II	AT2G42830	-

Functional Description ? help Back to Top
Source	Description
TAIR	AGAMOUS [AG]-like MADS box protein (AGL5) involved in fruit development (valve margin and dehiscence zone differentiation). A putative direct target of AG. SHP2 has been shown to be a downstream gene of the complex formed by AG and SEP proteins (SEP4 alone does not form a functional complex with AG).
UniProt	Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269\|PubMed:27776173}.

Function -- GeneRIF ? help Back to Top
Bisindolylmaleimide I abolishes the FGF2-mediated association of Shp2 tyrosine phosphatase with Frs2 and Gab1. [PMID: 17145761] SHP1/2 and TAGL1, while distinct in molecular function, regulate similar activities via their necessity for seed dispersal in Arabidopsis and tomato, respectively. [PMID: 19880793] The present work identifies a new function for SHP1 and SHP2 genes in promoting stigma, style and medial tissue development. [PMID: 19900437] The stk shp1 shp2 ant quadruple mutant ovule lacks integument development as in ant single mutant. [PMID: 20041269] Gab1/SHP2/p38MAPK signaling pathway and Ang-2 have an essential role in regulating thrombin-induced monocyte adhesion and vascular leakage [PMID: 27241812] Study identified new roles for SHP1 and SHP2: they are required for synchronized ovule maturation and subsequent fertilization/seed maturation, seed mucilage production, and have an inhibitory effect which is antagonistic to the ABS function in controlling formative divisions and cell shape of the inner integument and seed coat layers. [PMID: 27776173]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G42830.2

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT2G45190 (A), AT4G09960 (A), AT4G36920 (R), AT5G02030 (R), AT5G60910 (R)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT4G00120(A), AT5G67110(A)

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT2G45650, AT2G45660, AT3G57230, AT4G37940, AT5G13790, AT5G15800, AT1G24260, AT1G48150
IntAct	Search P29385

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G42830

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT029453	0.0	BT029453.1 Arabidopsis thaliana At2g42830 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_850377.1	0.0	K-box region and MADS-box transcription factor family protein
Swissprot	P29385	1e-180	AGL5_ARATH; Agamous-like MADS-box protein AGL5
TrEMBL	Q5XXG9	1e-178	Q5XXG9_ARATH; SHATTERPROOF2
STRING	AT2G42830.2	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM3341	23	50
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT2G42830.2
Entrez Gene	818883
iHOP	AT2G42830
wikigenes	AT2G42830

Publications ? help Back to Top
Liljegren SJ, et al. SHATTERPROOF MADS-box genes control seed dispersal in Arabidopsis. Nature, 2000. 404(6779): p. 766-70 [PMID:10783890] Smyth D A reverse trend--MADS functions revealed. Trends Plant Sci., 2000. 5(8): p. 315-7 [PMID:10908873] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] M The MADS-box gene DEFH28 from Antirrhinum is involved in the regulation of floral meristem identity and fruit development. Plant J., 2001. 28(2): p. 169-79 [PMID:11722760] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Favaro R, et al. MADS-box protein complexes control carpel and ovule development in Arabidopsis. Plant Cell, 2003. 15(11): p. 2603-11 [PMID:14555696] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Bao X,Franks RG,Levin JZ,Liu Z Repression of AGAMOUS by BELLRINGER in floral and inflorescence meristems. Plant Cell, 2004. 16(6): p. 1478-89 [PMID:15155890] Moore RC,Grant SR,Purugganan MD Molecular population genetics of redundant floral-regulatory genes in Arabidopsis thaliana. Mol. Biol. Evol., 2005. 22(1): p. 91-103 [PMID:15371526] Lee JY, et al. Activation of CRABS CLAW in the Nectaries and Carpels of Arabidopsis. Plant Cell, 2005. 17(1): p. 25-36 [PMID:15598802] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Kaufmann K,Anfang N,Saedler H,Theissen G Mutant analysis, protein-protein interactions and subcellular localization of the Arabidopsis B sister (ABS) protein. Mol. Genet. Genomics, 2005. 274(2): p. 103-18 [PMID:16080001] Causier B, et al. Evolution in action: following function in duplicated floral homeotic genes. Curr. Biol., 2005. 15(16): p. 1508-12 [PMID:16111944] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Battaglia R,Brambilla V,Colombo L,Stuitje AR,Kater MM Functional analysis of MADS-box genes controlling ovule development in Arabidopsis using the ethanol-inducible alc gene-expression system. Mech. Dev., 2006. 123(4): p. 267-76 [PMID:16515858] Ma H,Yanofsky MF,Meyerowitz EM AGL1-AGL6, an Arabidopsis gene family with similarity to floral homeotic and transcription factor genes. Genes Dev., 1991. 5(3): p. 484-95 [PMID:1672119] de Folter S, et al. A Bsister MADS-box gene involved in ovule and seed development in petunia and Arabidopsis. Plant J., 2006. 47(6): p. 934-46 [PMID:16925602] Balanz Patterning the female side of Arabidopsis: the importance of hormones. J. Exp. Bot., 2006. 57(13): p. 3457-69 [PMID:17023565] Krejci P, et al. Bisindolylmaleimide I suppresses fibroblast growth factor-mediated activation of Erk MAP kinase in chondrocytes by preventing Shp2 association with the Frs2 and Gab1 adaptor proteins. J. Biol. Chem., 2007. 282(5): p. 2929-36 [PMID:17145761] Brambilla V, et al. Genetic and molecular interactions between BELL1 and MADS box factors support ovule development in Arabidopsis. Plant Cell, 2007. 19(8): p. 2544-56 [PMID:17693535] Liu Z,Zhou C,Wu K Creation and analysis of a novel chimeric promoter for the complete containment of pollen- and seed-mediated gene flow. Plant Cell Rep., 2008. 27(6): p. 995-1004 [PMID:18317776] Manzano C,Abraham Z,L Identification of ubiquitinated proteins in Arabidopsis. Plant Mol. Biol., 2008. 68(1-2): p. 145-58 [PMID:18535787] Mitsuda N,Ohme-Takagi M NAC transcription factors NST1 and NST3 regulate pod shattering in a partially redundant manner by promoting secondary wall formation after the establishment of tissue identity. Plant J., 2008. 56(5): p. 768-78 [PMID:18657234] Mummenhoff K,Polster A,M Lepidium as a model system for studying the evolution of fruit development in Brassicaceae. J. Exp. Bot., 2009. 60(5): p. 1503-13 [PMID:19052256] Chang IF, et al. Proteomic profiling of tandem affinity purified 14-3-3 protein complexes in Arabidopsis thaliana. Proteomics, 2009. 9(11): p. 2967-85 [PMID:19452453] Mitsuda N,Ohme-Takagi M Functional analysis of transcription factors in Arabidopsis. Plant Cell Physiol., 2009. 50(7): p. 1232-48 [PMID:19478073] Vrebalov J, et al. Fleshy fruit expansion and ripening are regulated by the Tomato SHATTERPROOF gene TAGL1. Plant Cell, 2009. 21(10): p. 3041-62 [PMID:19880793] Colombo M, et al. A new role for the SHATTERPROOF genes during Arabidopsis gynoecium development. Dev. Biol., 2010. 337(2): p. 294-302 [PMID:19900437] Losa A,Colombo M,Brambilla V,Colombo L Genetic interaction between AINTEGUMENTA (ANT) and the ovule identity genes SEEDSTICK (STK), SHATTERPROOF1 (SHP1) and SHATTERPROOF2 (SHP2). Sex. Plant Reprod., 2010. 23(2): p. 115-21 [PMID:20041269] Irish VF The flowering of Arabidopsis flower development. Plant J., 2010. 61(6): p. 1014-28 [PMID:20409275] Matias-Hernandez L, et al. VERDANDI is a direct target of the MADS domain ovule identity complex and affects embryo sac differentiation in Arabidopsis. Plant Cell, 2010. 22(6): p. 1702-15 [PMID:20581305] Hanada K, et al. Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana. Mol. Biol. Evol., 2011. 28(1): p. 377-82 [PMID:20736450] Yang Y,Karlson DT Overexpression of AtCSP4 affects late stages of embryo development in Arabidopsis. J. Exp. Bot., 2011. 62(6): p. 2079-91 [PMID:21282328] Gomez MD,Urbez C,Perez-Amador MA,Carbonell J Characterization of constricted fruit (ctf) mutant uncovers a role for AtMYB117/LOF1 in ovule and fruit development in Arabidopsis thaliana. PLoS ONE, 2011. 6(4): p. e18760 [PMID:21533201] Severing EI, et al. Predicting the impact of alternative splicing on plant MADS domain protein function. PLoS ONE, 2012. 7(1): p. e30524 [PMID:22295091] M Evidence that an evolutionary transition from dehiscent to indehiscent fruits in Lepidium (Brassicaceae) was caused by a change in the control of valve margin identity genes. Plant J., 2013. 73(5): p. 824-35 [PMID:23173897] Pabón-Mora N,Wong GK,Ambrose BA Evolution of fruit development genes in flowering plants. Front Plant Sci, 2014. 5: p. 300 [PMID:25018763] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Rathnakumar K, et al. Angiopoietin-2 mediates thrombin-induced monocyte adhesion and endothelial permeability. J. Thromb. Haemost., 2016. 14(8): p. 1655-67 [PMID:27241812] Balanzà V,Roig-Villanova I,Di Marzo M,Masiero S,Colombo L Seed abscission and fruit dehiscence required for seed dispersal rely on similar genetic networks. Development, 2016. 143(18): p. 3372-81 [PMID:27510967] Ehlers K, et al. The MADS Box Genes ABS, SHP1, and SHP2 Are Essential for the Coordination of Cell Divisions in Ovule and Seed Coat Development and for Endosperm Formation in Arabidopsis thaliana. PLoS ONE, 2016. 11(10): p. e0165075 [PMID:27776173] Sehra B,Franks RG Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development. Front Plant Sci, 2017. 8: p. 1712 [PMID:29085379] Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers. Development, 2018. [PMID:29361563] Savidge B,Rounsley SD,Yanofsky MF Temporal relationship between the transcription of two Arabidopsis MADS box genes and the floral organ identity genes. Plant Cell, 1995. 7(6): p. 721-33 [PMID:7647563]