PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g091550.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 236aa    MW: 27184 Da    PI: 9.6168
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g091550.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.32e-281059251
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        ri+n++ rqvtfskRrng+lKKA+EL +LCdaev +iifsstgklye+s+
  Sopim02g091550.0.1 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGLIIFSSTGKLYEFSN 59
                        8***********************************************95 PP

2K-box78.81.4e-26821701098
               K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                           ++ + +q+e++ L+++++ Lq ++R+llGe+L+ L +keL +Le+qLe slk iR kK+++l+++i+el +k   +++en++L kk+
  Sopim02g091550.0.1  82 PVSELKLWQREAEILRQQLQDLQDNHRQLLGEELSGLGVKELTNLENQLEMSLKGIRMKKEQILKDEIQELTRKGSIIHQENMELYKKV 170
                         4567789*******************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.903161IPR002100Transcription factor, MADS-box
SMARTSM004329.2E-40160IPR002100Transcription factor, MADS-box
CDDcd002655.46E-45275No hitNo description
SuperFamilySSF554551.96E-32290IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-283859IPR002100Transcription factor, MADS-box
PfamPF014863.0E-2685170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.14786176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGLIIFSS TGKLYEFSNT  60
SMKSVIERYN KTKDDCQQLH NPVSELKLWQ REAEILRQQL QDLQDNHRQL LGEELSGLGV  120
KELTNLENQL EMSLKGIRMK KEQILKDEIQ ELTRKGSIIH QENMELYKKV NLIRQENAEL  180
YKKAYGARDA NAVNGNVNYP YRFTVSREVQ APIHLQLSQP EPQYFEMQAG TSDSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A6e-20169169MEF2C
5f28_B6e-20169169MEF2C
5f28_C6e-20169169MEF2C
5f28_D6e-20169169MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2153772e-96AC215377.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0073P13, complete sequence.
GenBankHG9755142e-96HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019067646.11e-173MADS-box transcription factor 23 isoform X2
SwissprotQ6EP491e-109MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A3Q7FAV71e-172A0A3Q7FAV7_SOLLC; Uncharacterized protein
STRINGSolyc02g091550.1.11e-173(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6792056
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.11e-100AGAMOUS-like 21
Publications ? help Back to Top
  1. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  2. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]