PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sopen05g029510.1

Organism

Solanum pennellii

Taxonomic ID

28526

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

G2-like

Protein Properties

Length: 174aa MW: 19607.8 Da PI: 6.509

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sopen05g029510.1	genome	spenn	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	103.7	1.1e-32	4	57	2	55
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+ Sopen05g029510.1 4 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 57 9****************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	9.351	1	60	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	5.8E-29	2	57	IPR009057	Homeodomain-like
SuperFamily	SSF46689	8.06E-16	2	58	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	6.0E-24	4	57	IPR006447	Myb domain, plants
Pfam	PF00249	5.5E-8	5	56	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 174 aa Download sequence Send to blast
MRAPRMRWTT SLHARFVHAV ELLGGHERAT PKSVLELMDV KDLTLAHVKS HLQMYRTVKT 60 TDKPAASSDG SGEEDLLAID KILDQRGPSD GCDEPSTTLW SNSSSRERLS QANFNESNGL 120 IRSSSFPSQQ RFSHHIEECE YSRAMSYVGC SLDQKNPSLE FTLGRSDWVE KNHD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4k_A	4e-18	5	59	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B	4e-18	5	59	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A	4e-18	5	59	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C	4e-18	5	59	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D	4e-18	5	59	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F	4e-18	5	59	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H	4e-18	5	59	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J	4e-18	5	59	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269\|PubMed:11395775, ECO:0000269\|PubMed:11525739, ECO:0000269\|PubMed:14561401, ECO:0000269\|PubMed:15286295, ECO:0000269\|PubMed:16623911, ECO:0000269\|PubMed:17307928, ECO:0000269\|PubMed:18849474, ECO:0000269\|PubMed:20179097}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269\|PubMed:18849474}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC239583	3e-57	AC239583.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 5 clone C05HBa0201O22, complete sequence.
GenBank	HG975444	3e-57	HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBank	HG975517	3e-57	HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015077008.1	1e-127	transcription repressor KAN1-like isoform X2
Swissprot	Q93WJ9	1e-52	KAN1_ARATH; Transcription repressor KAN1
TrEMBL	A0A3Q7GNA5	1e-123	A0A3Q7GNA5_SOLLC; Uncharacterized protein
STRING	Solyc05g051060.2.1	1e-124	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2468	23	55

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G16560.1	1e-52	G2-like family protein

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang T,Kerstetter RA,Irish VF APUM23, a PUF family protein, functions in leaf development and organ polarity in Arabidopsis. J. Exp. Bot., 2014. 65(4): p. 1181-91 [PMID:24449383] Mach J Getting in Shape? Leaves work it out with KANADI1. Plant Cell, 2014. 26(1): p. 4 [PMID:24464293] Jun SE, et al. Comparative analysis of the conserved functions of Arabidopsis DRL1 and yeast KTI12. Mol. Cells, 2015. 38(3): p. 243-50 [PMID:25518926] Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] Xie Y, et al. Meta-Analysis of Arabidopsis KANADI1 Direct Target Genes Identifies a Basic Growth-Promoting Module Acting Upstream of Hormonal Signaling Pathways. Plant Physiol., 2015. 169(2): p. 1240-53 [PMID:26246448] Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL Active suppression of a leaf meristem orchestrates determinate leaf growth. Elife, 2017. [PMID:27710768] Singh A, et al. Phytohormonal crosstalk modulates the expression of miR166/165s, target Class III HD-ZIPs, and KANADI genes during root growth in Arabidopsis thaliana. Sci Rep, 2017. 7(1): p. 3408 [PMID:28611467] Caggiano MP, et al. Cell type boundaries organize plant development. Elife, 2018. [PMID:28895530] Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers. Development, 2018. [PMID:29361563]