PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sp_182750_hxik.t1 | ||||||||
Common Name | SOVF_182750 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 159aa MW: 17891.7 Da PI: 5.2782 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 131.5 | 2.8e-41 | 1 | 81 | 17 | 97 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 mk++lP akisk ket+qecv+efisfvt+easdkc++e+rkt+ngdd++wal+tlGf++y e++++yl+kyre+e+ek Sp_182750_hxik.t1 1 MKQILPPSAKISKGGKETMQECVTEFISFVTGEASDKCHKENRKTVNGDDICWALTTLGFDNYGEAITQYLHKYREFEREK 81 9*****************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 8.56E-29 | 1 | 86 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 8.4E-40 | 1 | 136 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.7E-17 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.1E-18 | 19 | 37 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 3.1E-18 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 3.1E-18 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MKQILPPSAK ISKGGKETMQ ECVTEFISFV TGEASDKCHK ENRKTVNGDD ICWALTTLGF 60 DNYGEAITQY LHKYREFERE KACQGKADDG GRVVGGAAAG GSSSSNEETY HHHHHEEEEA 120 TTIMFGNQQQ QQQQQQQQQP RLDVESSVFP LEFRIIDPK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 5e-32 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 5e-32 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021847156.1 | 1e-117 | nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O04027 | 1e-40 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A0K9QHV6 | 1e-116 | A0A0K9QHV6_SPIOL; Uncharacterized protein (Fragment) | ||||
STRING | XP_010674711.1 | 1e-67 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 1e-42 | nuclear factor Y, subunit B4 |
Publications ? help Back to Top | |||
---|---|---|---|
|