PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sof019058 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 147aa MW: 16437.1 Da PI: 9.5602 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 58.3 | 1.3e-18 | 36 | 89 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 k++++++e +++Le+ Fe ++++ e++++LA+ lgL+ rqV vWFqNrRa++k Sof019058 36 KKRRLSAEXVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 89 456899***********************************************9 PP | |||||||
2 | HD-ZIP_I/II | 127.8 | 4.7e-41 | 35 | 122 | 1 | 88 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 ekkrrls+e v++LE+sFe e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+ y+aL+++ydal++e+++L +++++L Sof019058 35 EKKRRLSAEXVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERGYAALRHSYDALSHEHDALPRDKDALL 122 69*********************************************************************************99985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 3.68E-19 | 26 | 93 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 16.925 | 31 | 91 | IPR001356 | Homeobox domain |
SMART | SM00389 | 3.8E-17 | 34 | 95 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 6.4E-16 | 36 | 89 | IPR001356 | Homeobox domain |
CDD | cd00086 | 6.77E-15 | 36 | 92 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.0E-19 | 37 | 97 | IPR009057 | Homeodomain-like |
PRINTS | PR00031 | 3.7E-6 | 62 | 71 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 66 | 89 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 3.7E-6 | 71 | 87 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 2.4E-10 | 91 | 122 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MTNPDDDGYG VVGMEADADA DEEMMACGGG GGGGEKKRRL SAEXVRALER SFEVENKLEP 60 ERKARLARDL GLQPRQVAVW FQNRRARWKT KQLERGYAAL RHSYDALSHE HDALPRDKDA 120 LLPRSRAQGK LGNKRHGNLT GQAEPRP |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 60 | 66 | ERKARLA |
2 | 83 | 91 | RRARWKTKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Sof.2853 | 0.0 | bud| inflorescence| leaf| meristem| root| seed| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaf and floral organ primordia, floral meristems, embryonic axis and cells surrounding the vascular bundles. Expressed in the vasculature of roots, stem, leaves and spikelets, and in the vascular bundle of the scutellum in embryos. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaf and floral organ primordia, floral meristems, embryonic axis and cells surrounding the vascular bundles. Expressed in the vasculature of roots, stem, leaves and spikelets, and in the vascular bundle of the scutellum in embryos. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. May be involved in the regulation of gibberellin signaling. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:18049796}. | |||||
UniProt | Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. May be involved in the regulation of gibberellin signaling. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:18049796}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By gibberellin. Down-regulated in leaves by drought stress. {ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. | |||||
UniProt | INDUCTION: By gibberellin. Down-regulated in leaves by drought stress. {ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004957072.1 | 5e-66 | homeobox-leucine zipper protein HOX4 | ||||
Swissprot | Q6K498 | 5e-65 | HOX4_ORYSJ; Homeobox-leucine zipper protein HOX4 | ||||
Swissprot | Q9XH37 | 5e-65 | HOX4_ORYSI; Homeobox-leucine zipper protein HOX4 | ||||
TrEMBL | K3ZW40 | 1e-64 | K3ZW40_SETIT; Uncharacterized protein | ||||
STRING | Si030822m | 2e-65 | (Setaria italica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G40060.1 | 7e-40 | homeobox protein 16 |
Publications ? help Back to Top | |||
---|---|---|---|
|