PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sof018338 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 159aa MW: 17290.4 Da PI: 10.5542 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 62.1 | 1.1e-19 | 11 | 56 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+W++eEd+ l ++v+++G ++W++I r+++ gR++k+c++rw + Sof018338 11 RGPWSPEEDDALRRLVERHGARNWTAIGREIP-GRSGKSCRLRWCNQ 56 89******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 57.7 | 2.7e-18 | 63 | 105 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 r ++T+eEd +v+a+++lG++ W++Iar ++ gRt++ +k++w+ Sof018338 63 RRPFTPEEDAAIVRAHARLGNR-WAAIARLLP-GRTDNAVKNHWN 105 679*******************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 25.62 | 6 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.28E-32 | 8 | 104 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.3E-17 | 10 | 59 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.8E-19 | 11 | 56 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.8E-26 | 12 | 64 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.17E-16 | 13 | 55 | No hit | No description |
SMART | SM00717 | 3.0E-16 | 62 | 110 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.9E-16 | 63 | 105 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.741 | 63 | 112 | IPR017930 | Myb domain |
CDD | cd00167 | 5.40E-13 | 65 | 105 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.8E-24 | 65 | 112 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MGAEVECDRI RGPWSPEEDD ALRRLVERHG ARNWTAIGRE IPGRSGKSCR LRWCNQLSPQ 60 VERRPFTPEE DAAIVRAHAR LGNRWAAIAR LLPGRTDNAV KNHWNCSLKR KLAAAVSGPG 120 VVSADAAADE IEAARPSKRV SLSPDSPSGS GRGPSPNVT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-40 | 8 | 112 | 4 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in leaves from the third leaf to rosette leaves from six-week old plants. Expression follows a development-dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems and flowers. Expressed in dry seeds (PubMed:9678577). Expressed in root vasculature, root tips and lateral root (PubMed:17675404). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:9678577}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002438718.1 | 8e-86 | transcription factor MYB44 | ||||
Swissprot | Q9SN12 | 2e-58 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A0C6WCM6 | 1e-108 | A0A0C6WCM6_9POAL; ScMYB23 protein | ||||
STRING | Sb10g024950.1 | 3e-85 | (Sorghum bicolor) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G67300.1 | 4e-57 | myb domain protein r1 |
Publications ? help Back to Top | |||
---|---|---|---|
|