PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G67300.1

Common Name

ATMYB44, ATMYBR1, K8K14.2, MYB44, MYBR1

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 305aa MW: 33268.2 Da PI: 8.1123

Description

myb domain protein r1

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G67300.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59.9	5.5e-19	6	51	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde+l ++v ++G+++W+ I++ ++ gR++k+c++rw + AT5G67300.1 6 KGPWSPEEDEQLRRLVVKYGPRNWTVISKSIP-GRSGKSCRLRWCNQ 51 79****************************.*********985 PP
2	Myb_DNA-binding	56.4	6.7e-18	60	102	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++eEde +++a++q+G++ W+tIar ++ gRt++ +k++w++ AT5G67300.1 60 PFSAEEDETIARAHAQFGNK-WATIARLLN-GRTDNAVKNHWNST 102 89****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	29.606	1	56	IPR017930	Myb domain
SuperFamily	SSF46689	3.0E-31	3	99	IPR009057	Homeodomain-like
SMART	SM00717	1.6E-17	5	54	IPR001005	SANT/Myb domain
Pfam	PF00249	8.8E-19	6	51	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	8.7E-25	7	58	IPR009057	Homeodomain-like
CDD	cd00167	7.72E-17	8	50	No hit	No description
SMART	SM00717	1.3E-14	57	105	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	19.77	58	107	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.4E-22	59	106	IPR009057	Homeodomain-like
CDD	cd00167	8.77E-12	60	103	No hit	No description
Pfam	PF00249	7.0E-15	60	102	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009414	Biological Process	response to water deprivation
GO:0009651	Biological Process	response to salt stress
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009737	Biological Process	response to abscisic acid
GO:0009738	Biological Process	abscisic acid-activated signaling pathway
GO:0009739	Biological Process	response to gibberellin
GO:0010200	Biological Process	response to chitin
GO:0030154	Biological Process	cell differentiation
GO:0042742	Biological Process	defense response to bacterium
GO:0046686	Biological Process	response to cadmium ion
GO:0050832	Biological Process	defense response to fungus
GO:2000022	Biological Process	regulation of jasmonic acid mediated signaling pathway
GO:2000031	Biological Process	regulation of salicylic acid mediated signaling pathway
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000034	anatomy	vascular system
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 305 aa Download sequence Send to blast
MADRIKGPWS PEEDEQLRRL VVKYGPRNWT VISKSIPGRS GKSCRLRWCN QLSPQVEHRP 60 FSAEEDETIA RAHAQFGNKW ATIARLLNGR TDNAVKNHWN STLKRKCGGY DHRGYDGSED 120 HRPVKRSVSA GSPPVVTGLY MSPGSPTGSD VSDSSTIPIL PSVELFKPVP RPGAVVLPLP 180 IETSSSSDDP PTSLSLSLPG ADVSEESNRS HESTNINNTT SSRHNHNNTV SFMPFSGGFR 240 GAIEEMGKSF PGNGGEFMAV VQEMIKAEVR SYMTEMQRNN GGGFVGGFID NGMIPMSQIG 300 VGRIE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	3e-39	5	107	3	105	MYB PROTO-ONCOGENE PROTEIN
1h88_C	1e-38	5	106	57	158	MYB PROTO-ONCOGENE PROTEIN
1h89_C	1e-38	5	106	57	158	MYB PROTO-ONCOGENE PROTEIN
1mse_C	2e-39	5	107	3	105	C-Myb DNA-Binding Domain
1msf_C	2e-39	5	107	3	105	C-Myb DNA-Binding Domain
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.28816	0.0	bud\| flower\| leaf\| root\| seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	145359776	0.0
Genevisible	246987_at	0.0
Expression Atlas	AT5G67300	-
AtGenExpress	AT5G67300	-
ATTED-II	AT5G67300	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed during very late stages of embryogenesis. Later, its expression follows a development dependent gradient in successive leaves. {ECO:0000269\|PubMed:9678577}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, leaves, inflorescence, and flowers (including stamen, floral nectar, carpel, petal and sepal), mostly in vasculatures and stomata. {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:9678577}.

Functional Description ? help Back to Top
Source	Description
TAIR	Member of the R2R3 factor MYB gene family involved in mediating plant responses to a variety of abiotic stimiuli.
UniProt	Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202, ECO:0000269\|PubMed:23603962, ECO:0000269\|PubMed:24894996, ECO:0000269\|PubMed:9678577}.

Function -- GeneRIF ? help Back to Top
Enhanced abiotic stress tolerance of transgenic Arabidopsis overexpressing AtMYB44 was conferred by reduced expression of genes encoding a group of serine/threonine protein phosphatases 2C. [PMID: 18162593] AtMYB44 gene activation appears to not be induced by any specific hormone [PMID: 20016937] AtMYB44 regulates induced expression of EIN2 in HrpN(Ea)-treated Arabidopsis plants. AtMYB44 protein localizes to nuclei and binds the EIN2 promoter; HrpN(Ea) treatment promotes AtMYB44 production, binding activity, and transcription of AtMYB44 and EIN2. [PMID: 21117868] HrpN Ea-induced deterrent effect on phloem feeding of the green peach aphid Myzus persicae requires AtGSL5 and AtMYB44 genes in Arabidopsis thaliana. [PMID: 21451254] the transcriptional regulator MYB44 has a role in the control of seed germination in Arabidopsis thaliana. [PMID: 22704933] AtMYB44 modulates antagonistic interaction by activating SA-mediated defenses and repressing JA-mediated defenses through direct control of WRKY70 [PMID: 23067202] the C-terminal side of the protein, but not the N-terminal side of the R2R3 domain, contributes to the functional activity and specificity of AtMYB44 through interactions with other regulators generated by each of a variety of stimuli. [PMID: 23161171] MYB44 is regulated by MPK3 via phosphorylation whereby initiating the adaptation response to numerous abiotic and biotic stresses. [PMID: 23437396] AtMYB44 is an integrator of cross-talk between salicylic acid and jasmonic acid in plant defense responses. [PMID: 23603962] Dominant repression by Arabidopsis transcription factor MYB44 causes oxidative damage and hypersensitivity to abiotic stress. [PMID: 24531138] The authors herein revealed that the MYB44-mediated prevention of Pseudomonas syringae penetration through the stomata is one of the components responsible for Penicillium simplicissimum GP17-2-elicited induced systemic resistance. [PMID: 27301421] AtMYB44 might participate in the 3OC6-HSL-mediated primary root growth via regulating the expression of cytokinin- and auxin-related genes. The data establish a genetic connection between the regulatory role of AtMYB44 in phytohormones-related gene expression and plant response to the bacterial QS signal. [PMID: 27604593] salt stress induces the eviction of H2A.Z-containing nucleosomes from the AtMYB44 promoter region. [PMID: 29649476] AtMYB44 forms a complex with TPR corepressors and recruits histone deacetylase(s) to suppress PP2C gene transcription in a signal-independent manner. [PMID: 30448055]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00596	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G67300.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT3G26790 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G17550(R), AT1G72770(R), AT3G11410(R), AT4G26080(R), AT5G03280(A), AT5G44420(R), AT5G57050(R)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, auxin, ethylene, gibberellin, jasmonic acid, Jasmonic acid, salicylic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G67300

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G67300

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB007645	0.0	AB007645.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K8K14.
GenBank	AF326877	0.0	AF326877.1 Arabidopsis thaliana putative myb-related protein, 33.3K (At5g67300) mRNA, complete cds.
GenBank	AF339698	0.0	AF339698.1 Arabidopsis thaliana putative myb-related protein, 33.3K (At5g67300) mRNA, complete cds.
GenBank	AY519648	0.0	AY519648.1 Arabidopsis thaliana MYB transcription factor (At5g67300) mRNA, complete cds.
GenBank	CP002688	0.0	CP002688.1 Arabidopsis thaliana chromosome 5 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_201531.1	0.0	myb domain protein r1
Swissprot	Q9FDW1	0.0	MYB44_ARATH; Transcription factor MYB44
TrEMBL	A0A178UQ74	0.0	A0A178UQ74_ARATH; MYBR1
STRING	AT5G67300.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM677	28	135
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT5G67300.1
Entrez Gene	836865
iHOP	AT5G67300
wikigenes	AT5G67300

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Kersten B, et al. Generation of Arabidopsis protein chips for antibody and serum screening. Plant Mol. Biol., 2003. 52(5): p. 999-1010 [PMID:14558660] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Leonhardt N, et al. Microarray expression analyses of Arabidopsis guard cells and isolation of a recessive abscisic acid hypersensitive protein phosphatase 2C mutant. Plant Cell, 2004. 16(3): p. 596-615 [PMID:14973164] Ko JH,Han KH,Park S,Yang J Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling. Plant Physiol., 2004. 135(2): p. 1069-83 [PMID:15194820] Reymond P, et al. A conserved transcript pattern in response to a specialist and a generalist herbivore. Plant Cell, 2004. 16(11): p. 3132-47 [PMID:15494554] Devoto A, et al. Expression profiling reveals COI1 to be a key regulator of genes involved in wound- and methyl jasmonate-induced secondary metabolism, defence, and hormone interactions. Plant Mol. Biol., 2005. 58(4): p. 497-513 [PMID:16021335] Lee BH,Henderson DA,Zhu JK The Arabidopsis cold-responsive transcriptome and its regulation by ICE1. Plant Cell, 2005. 17(11): p. 3155-75 [PMID:16214899] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Ma S,Bohnert HJ Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression. Genome Biol., 2007. 8(4): p. R49 [PMID:17408486] Shin R, et al. The Arabidopsis transcription factor MYB77 modulates auxin signal transduction. Plant Cell, 2007. 19(8): p. 2440-53 [PMID:17675404] Libault M,Wan J,Czechowski T,Udvardi M,Stacey G Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11 [PMID:17722694] Wang Z, et al. Identification and characterization of COI1-dependent transcription factor genes involved in JA-mediated response to wounding in Arabidopsis plants. Plant Cell Rep., 2008. 27(1): p. 125-35 [PMID:17786451] Jung C, et al. Overexpression of AtMYB44 enhances stomatal closure to confer abiotic stress tolerance in transgenic Arabidopsis. Plant Physiol., 2008. 146(2): p. 623-35 [PMID:18162593] Sreenivasulu N, et al. Barley grain maturation and germination: metabolic pathway and regulatory network commonalities and differences highlighted by new MapMan/PageMan profiling tools. Plant Physiol., 2008. 146(4): p. 1738-58 [PMID:18281415] Huang D,Wu W,Abrams SR,Cutler AJ The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors. J. Exp. Bot., 2008. 59(11): p. 2991-3007 [PMID:18552355] Pitzschke A,Djamei A,Teige M,Hirt H VIP1 response elements mediate mitogen-activated protein kinase 3-induced stress gene expression. Proc. Natl. Acad. Sci. U.S.A., 2009. 106(43): p. 18414-9 [PMID:19820165] Jung C, et al. Non-specific phytohormonal induction of AtMYB44 and suppression of jasmonate-responsive gene activation in Arabidopsis thaliana. Mol. Cells, 2010. 29(1): p. 71-6 [PMID:20016937] Liu R, et al. Thirty-seven transcription factor genes differentially respond to a harpin protein and affect resistance to the green peach aphid in Arabidopsis. J. Biosci., 2010. 35(3): p. 435-50 [PMID:20826953] Liu R, et al. Transcription factor AtMYB44 regulates induced expression of the ETHYLENE INSENSITIVE2 gene in Arabidopsis responding to a harpin protein. Mol. Plant Microbe Interact., 2011. 24(3): p. 377-89 [PMID:21117868] L HrpN Ea-induced deterrent effect on phloem feeding of the green peach aphid Myzus persicae requires AtGSL5 and AtMYB44 genes in Arabidopsis thaliana. J. Biosci., 2011. 36(1): p. 123-37 [PMID:21451254] Causier B,Ashworth M,Guo W,Davies B The TOPLESS interactome: a framework for gene repression in Arabidopsis. Plant Physiol., 2012. 158(1): p. 423-38 [PMID:22065421] Nguyen XC, et al. Phosphorylation of the transcriptional regulator MYB44 by mitogen activated protein kinase regulates Arabidopsis seed germination. Biochem. Biophys. Res. Commun., 2012. 423(4): p. 703-8 [PMID:22704933] Shim JS, et al. AtMYB44 regulates WRKY70 expression and modulates antagonistic interaction between salicylic acid and jasmonic acid signaling. Plant J., 2013. 73(3): p. 483-95 [PMID:23067202] Jung C, et al. Quadruple 9-mer-based protein binding microarray analysis confirms AACnG as the consensus nucleotide sequence sufficient for the specific binding of AtMYB44. Mol. Cells, 2012. 34(6): p. 531-7 [PMID:23161171] Persak H,Pitzschke A Tight interconnection and multi-level control of Arabidopsis MYB44 in MAPK cascade signalling. PLoS ONE, 2013. 8(2): p. e57547 [PMID:23437396] Shim JS,Choi YD Direct regulation of WRKY70 by AtMYB44 in plant defense responses. Plant Signal Behav, 2013. 8(6): p. e20783 [PMID:23603962] L AtMYB44 regulates resistance to the green peach aphid and diamondback moth by activating EIN2-affected defences in Arabidopsis. Plant Biol (Stuttg), 2013. 15(5): p. 841-50 [PMID:23656500] Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance. Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62 [PMID:24275141] Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence. BMC Plant Biol., 2013. 13: p. 192 [PMID:24286353] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Persak H,Pitzschke A Dominant repression by Arabidopsis transcription factor MYB44 causes oxidative damage and hypersensitivity to abiotic stress. Int J Mol Sci, 2014. 15(2): p. 2517-37 [PMID:24531138] Li D, et al. Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44. Int J Mol Sci, 2014. 15(5): p. 8473-90 [PMID:24828206] Zhao Y, et al. The ABA receptor PYL8 promotes lateral root growth by enhancing MYB77-dependent transcription of auxin-responsive genes. Sci Signal, 2014. 7(328): p. ra53 [PMID:24894996] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Hieno A, et al. Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis. Microbes Environ., 2016. 31(2): p. 154-9 [PMID:27301421] Zhao Q, et al. AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana. Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785 [PMID:27604593] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Nguyen NH,Cheong JJ H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress. Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043 [PMID:29649476] Nguyen NH,Cheong JJ AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription. Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442 [PMID:30448055] Kirik V,K Two novel MYB homologues with changed expression in late embryogenesis-defective Arabidopsis mutants. Plant Mol. Biol., 1998. 37(5): p. 819-27 [PMID:9678577]