PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sof017409 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 173aa MW: 19698.9 Da PI: 9.5826 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 181.7 | 1.8e-56 | 23 | 150 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100 lppGfrFhPtdee+v++yL++k+ ++++++ vi++vd++k+ePwdLp+k+k +ekewyfF+++d+ky+tg r+nrat+sgyWkatgkdke+++ ++ lv Sof017409 23 LPPGFRFHPTDEEVVTHYLTNKALNSSFSC-VVIADVDLNKIEPWDLPSKAKMGEKEWYFFCHKDRKYPTGMRTNRATASGYWKATGKDKEIFRGHRVLV 121 79**************************99.78***************99999*****************************************99999* PP NAM 101 glkktLvfykgrapkgektdWvmheyrle 129 g+kktLvfy+grap+g kt Wvmheyrle Sof017409 122 GMKKTLVFYTGRAPRGGKTPWVMHEYRLE 150 ***************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.35E-62 | 20 | 173 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.316 | 23 | 173 | IPR003441 | NAC domain |
Pfam | PF02365 | 7.8E-30 | 24 | 149 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MASEVSSETN QQGGGEEETR LDLPPGFRFH PTDEEVVTHY LTNKALNSSF SCVVIADVDL 60 NKIEPWDLPS KAKMGEKEWY FFCHKDRKYP TGMRTNRATA SGYWKATGKD KEIFRGHRVL 120 VGMKKTLVFY TGRAPRGGKT PWVMHEYRLE GSLAXXLRRG GKDEWAVCKV VTK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-56 | 19 | 173 | 13 | 165 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-56 | 19 | 173 | 13 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-56 | 19 | 173 | 13 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-56 | 19 | 173 | 13 | 165 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-56 | 19 | 173 | 16 | 168 | NAC domain-containing protein 19 |
3swm_B | 2e-56 | 19 | 173 | 16 | 168 | NAC domain-containing protein 19 |
3swm_C | 2e-56 | 19 | 173 | 16 | 168 | NAC domain-containing protein 19 |
3swm_D | 2e-56 | 19 | 173 | 16 | 168 | NAC domain-containing protein 19 |
3swp_A | 2e-56 | 19 | 173 | 16 | 168 | NAC domain-containing protein 19 |
3swp_B | 2e-56 | 19 | 173 | 16 | 168 | NAC domain-containing protein 19 |
3swp_C | 2e-56 | 19 | 173 | 16 | 168 | NAC domain-containing protein 19 |
3swp_D | 2e-56 | 19 | 173 | 16 | 168 | NAC domain-containing protein 19 |
4dul_A | 2e-56 | 19 | 173 | 13 | 165 | NAC domain-containing protein 19 |
4dul_B | 2e-56 | 19 | 173 | 13 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002461233.1 | 1e-118 | NAC domain-containing protein 79 | ||||
Swissprot | Q9FK44 | 9e-79 | NAC87_ARATH; NAC domain-containing protein 87 | ||||
TrEMBL | C5X5P9 | 1e-116 | C5X5P9_SORBI; Uncharacterized protein | ||||
STRING | Sb02g043270.1 | 1e-117 | (Sorghum bicolor) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G18270.2 | 2e-81 | Arabidopsis NAC domain containing protein 87 |
Publications ? help Back to Top | |||
---|---|---|---|
|