PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sof016952 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 179aa MW: 19384.4 Da PI: 10.6336 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.2 | 4.3e-14 | 94 | 138 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ +++ + ++lG+g+W+ I+r + Rt+ q+ s+ qky Sof016952 94 PWTEEEHRRFLLGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKY 138 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.60.10 | 2.6E-4 | 3 | 21 | IPR001878 | Zinc finger, CCHC-type |
PROSITE profile | PS51294 | 20.199 | 87 | 143 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 9.72E-18 | 89 | 144 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 5.8E-20 | 90 | 142 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 1.0E-10 | 91 | 141 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.9E-12 | 91 | 137 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.9E-11 | 94 | 138 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.12E-10 | 94 | 139 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MTRRCSHCSH NGHNSRTCPN RGVKIFGVRL TDGSAIRKSA SMGNLSLLSA GSTSGGASPA 60 DGPDLADGGA GGYASDDFVQ GSSSASRERK KGVPWTEEEH RRFLLGLQKL GKGDWRGISR 120 NFVVSRTPTQ VASHAQKYFI RQSNMSRRKR RSSLFDMVPD ESMDLPPLPG SQEPETSVX |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Sof.7975 | 4e-50 | bud| callus| crown| inflorescence| leaf| meristem| root| seed |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in all tissues, with the highest level in senescent leaves. {ECO:0000269|PubMed:12172034}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002464930.1 | 1e-128 | transcription factor MYBS3 | ||||
Swissprot | Q7XC57 | 1e-118 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
TrEMBL | A0A0C6WCR8 | 1e-127 | A0A0C6WCR8_9POAL; ScMYB41 protein | ||||
STRING | Sb01g029020.1 | 1e-128 | (Sorghum bicolor) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47390.1 | 2e-73 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|