PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sof012917 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 223aa MW: 25788.6 Da PI: 9.3716 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 38.3 | 3.1e-12 | 31 | 78 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47 ++WT+eE +++ +a +q + +W+++a++++ ++t+ +++++++++ Sof012917 31 DAWTAEENKQFEKALAQIDRNapdRWEKVAEMVP-RKTADDVRNHYHDL 78 58*****************99*************.***********976 PP | |||||||
2 | Myb_DNA-binding | 47.6 | 3.9e-15 | 134 | 178 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + kq+G g+W+ I+r+ ++Rt+ q+ s+ qky Sof012917 134 PWTEEEHRLFLMGLKQYGRGDWRNISRKYVTTRTPTQVASHAQKY 178 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51293 | 8.922 | 28 | 81 | IPR017884 | SANT domain |
SMART | SM00717 | 5.4E-10 | 29 | 81 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 6.68E-12 | 31 | 85 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.09E-8 | 32 | 78 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.5E-7 | 32 | 77 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.7E-10 | 32 | 78 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.216 | 127 | 183 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.28E-18 | 128 | 183 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.8E-17 | 130 | 181 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 8.0E-13 | 131 | 181 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-11 | 131 | 177 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.34E-10 | 134 | 179 | No hit | No description |
Pfam | PF00249 | 4.1E-12 | 134 | 178 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 223 aa Download sequence Send to blast |
MAEAWRPMML APTAPCFWQQ DTHSVFWRRG DAWTAEENKQ FEKALAQIDR NAPDRWEKVA 60 EMVPRKTADD VRNHYHDLEN DVGFIEAGLV PFPHYSSSVP SSGFTLEDWD GAFRRGYCLK 120 RARGSDQERK KGVPWTEEEH RLFLMGLKQY GRGDWRNISR KYVTTRTPTQ VASHAQKYFI 180 RLNSGGKDKR RSSIHDITTV NLPDEDHGNA PPSAAFFGNT RRX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 4e-17 | 30 | 98 | 8 | 76 | RADIALIS |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001131480.1 | 1e-141 | uncharacterized protein LOC100192816 | ||||
Swissprot | Q8S9H7 | 4e-74 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A0C6WCM9 | 1e-164 | A0A0C6WCM9_9POAL; ScMYB38 protein | ||||
STRING | GRMZM2G125522_P01 | 1e-141 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G58900.1 | 1e-76 | Homeodomain-like transcriptional regulator |
Publications ? help Back to Top | |||
---|---|---|---|
|