PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sof012885

Organism

Saccharum officinarum

Taxonomic ID

4547

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex

Family

NAC

Protein Properties

Length: 224aa MW: 24321.2 Da PI: 9.5876

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Sof#S17453486	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	170.9	4e-53	11	139	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 +ppGfrFhPt+eel+++yL+kkv++++++l +vi++vd++k+ePwd+++ k+ + +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++ Sof012885 11 VPPGFRFHPTEEELLNYYLRKKVASQEIDL-DVIRDVDLNKLEPWDIQEkcKIGSgPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYN-AV 108 69**************************.9***********952444443456**********************************.88 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 + +g++ktLvfykgrap+g+k+dW+mheyrl Sof012885 109 KRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139 99*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.31E-54	7	145	IPR003441	NAC domain
PROSITE profile	PS51005	51.357	11	167	IPR003441	NAC domain
Pfam	PF02365	1.1E-28	12	139	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 224 aa Download sequence Send to blast
MSISVNGQSC VPPGFRFHPT EEELLNYYLR KKVASQEIDL DVIRDVDLNK LEPWDIQEKC 60 KIGSGPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIYNAVKR IGMRKTLVFY 120 KGRAPHGQKS DWIMHEYRLD DPAAAGFRDA AGAAGRTVAA ACCVCGCVXG PRARGPLGGV 180 QVVQKEAPPQ GVFGPEAGPP NTGSNTKHGH GGGKGGCFCA LSKX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-45	8	143	14	146	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-45	8	143	14	146	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-45	8	143	14	146	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-45	8	143	14	146	NO APICAL MERISTEM PROTEIN
3swm_A	2e-45	8	143	17	149	NAC domain-containing protein 19
3swm_B	2e-45	8	143	17	149	NAC domain-containing protein 19
3swm_C	2e-45	8	143	17	149	NAC domain-containing protein 19
3swm_D	2e-45	8	143	17	149	NAC domain-containing protein 19
3swp_A	2e-45	8	143	17	149	NAC domain-containing protein 19
3swp_B	2e-45	8	143	17	149	NAC domain-containing protein 19
3swp_C	2e-45	8	143	17	149	NAC domain-containing protein 19
3swp_D	2e-45	8	143	17	149	NAC domain-containing protein 19
4dul_A	2e-45	8	143	14	146	NAC domain-containing protein 19
4dul_B	2e-45	8	143	14	146	NAC domain-containing protein 19
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Sof.1182	0.0	stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in various aboveground tissues undergoing thickening of the lignified secondary wall such as anthers, filaments of stamens, the base of carpels, styles, the boundaries between siliques and pedicels, the midrib of leaf veins, and inflorescence stems, specifically in interfascicular fibers (sclerenchyma), cells differentiating into vascular vessels, and xylary fibers (secondary xylem). {ECO:0000269\|PubMed:16214898, ECO:0000269\|PubMed:17237351}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269\|PubMed:16214898, ECO:0000269\|PubMed:17237351, ECO:0000269\|PubMed:17333250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020164672.1	1e-104	NAC domain-containing protein 43-like
Swissprot	Q84WP6	1e-92	NAC43_ARATH; NAC domain-containing protein 43
TrEMBL	A0A3L6RFU3	1e-104	A0A3L6RFU3_PANMI; Secondary wall NAC master switch
TrEMBL	A0A453S1C6	1e-104	A0A453S1C6_AEGTS; Uncharacterized protein
STRING	Traes_7AL_B000BC0DD.2	1e-105	(Triticum aestivum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G46770.1	2e-81	NAC family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Gondolf VM, et al. A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis. BMC Plant Biol., 2014. 14: p. 344 [PMID:25492673] Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons. GM Crops Food, 2014. 5(4): p. 302-20 [PMID:25523176] Yuan Y,Teng Q,Zhong R,Ye ZH TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan. Plant Cell Physiol., 2016. 57(1): p. 35-45 [PMID:26556650] Yang C, et al. Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation. Plant Physiol., 2017. 175(1): p. 333-350 [PMID:28724622] Pascual MB, et al. PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine. Plant Biotechnol. J., 2018. 16(5): p. 1094-1104 [PMID:29055073] Liu C,Yu H,Li L SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana. PLoS Genet., 2019. 15(1): p. e1007928 [PMID:30657769]