PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof012274
Organism
Saccharum officinarum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family bZIP
Protein Properties Length: 230aa    MW: 24976.1 Da    PI: 9.8998
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17380486PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.11.2e-15165207547
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                +r+rr++kNRe+A rsR+RK+a+i eLe +v++L+ +N++L+ 
  Sof012274 165 RRQRRMIKNRESAARSRARKQAYIMELEAEVAKLKDQNDELQX 207
                79*************************************9974 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.1E-13161224IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.898163208IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.49E-11165209No hitNo description
CDDcd147072.79E-21165220No hitNo description
Gene3DG3DSA:1.20.5.1708.2E-15165208No hitNo description
PfamPF001701.3E-12165208IPR004827Basic-leucine zipper domain
PROSITE patternPS000360168183IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
LSRTLSQKTV DEVWREIVGF TGGEDAQPVA APAPAPAPAP LPAQAQRQQT LGSMTLEELL  60
VRAGVVREDM GQQTLVLQPH AQGLFSQGNA VAPQTMQLGN GMVTGVVGQG LGGGMTVAAP  120
TTPVVLNGLG KVEAXDLSSL SPVPYPFDTA LRVRKGPTVE KVVERRQRRM IKNRESAARS  180
RARKQAYIME LEAEVAKLKD QNDELQXKSR LELPKRQKDE VLERINTNMD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.94250.0bud| callus| inflorescence| seed
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, leaves, flag leaves, stems, flowers and panicles (PubMed:20576316). Widely expressed (PubMed:21546455). {ECO:0000269|PubMed:20576316, ECO:0000269|PubMed:21546455}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abscisic acid (ABA) signaling pathway (PubMed:20576316, PubMed:19947981, PubMed:21546455, PubMed:22301130, PubMed:26300907, PubMed:27468891). Transcription factor activity is fully activated by ABA (PubMed:19947981, PubMed:26300907, PubMed:27468891). Acts as positive regulator of the expression of abiotic stress-responsive genes through an ABA-dependent signaling pathway (PubMed:20576316). Acts as positive regulator of ABA signaling and drought stress tolerance (PubMed:22301130). Plays an important role in ABA and auxin responses. Involved in ABA signaling and stress responses by directly binding to the ABA-responsive element (ABRE)-containing genes, especially WRKY family genes. Modulates response to auxin. Suppresses auxin signaling by targeting ABRE-containing genes related to auxin metabolism or signaling (PubMed:21546455). {ECO:0000269|PubMed:19947981, ECO:0000269|PubMed:20576316, ECO:0000269|PubMed:21546455, ECO:0000269|PubMed:22301130, ECO:0000269|PubMed:26300907, ECO:0000269|PubMed:27468891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) (PubMed:20576316, PubMed:18315698, PubMed:21546455, PubMed:22301130). Induced by auxin (PubMed:21546455, PubMed:22301130). Induced by gibberellin (PubMed:21546455). Induced by salt and drought stresses (PubMed:20576316, PubMed:21546455, PubMed:22301130). Induced by cold stress (PubMed:20576316). Induced by oxidative stress (PubMed:20576316, PubMed:22301130). {ECO:0000269|PubMed:18315698, ECO:0000269|PubMed:20576316, ECO:0000269|PubMed:21546455, ECO:0000269|PubMed:22301130}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964902.11e-121bZIP transcription factor 46
SwissprotQ69TW59e-86BZP46_ORYSJ; bZIP transcription factor 46
TrEMBLA0A3L6S3191e-121A0A3L6S319_PANMI; ABSCISIC ACID-INSENSITIVE 5-like protein 5
STRINGSi006889m1e-120(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.12e-35abscisic acid responsive elements-binding factor 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Hossain MA, et al.
    The ABRE-binding bZIP transcription factor OsABF2 is a positive regulator of abiotic stress and ABA signaling in rice.
    J. Plant Physiol., 2010. 167(17): p. 1512-20
    [PMID:20576316]
  3. Yang X, et al.
    Rice ABI5-Like1 regulates abscisic acid and auxin responses by affecting the expression of ABRE-containing genes.
    Plant Physiol., 2011. 156(3): p. 1397-409
    [PMID:21546455]
  4. Li YS, et al.
    A novel nuclear protein phosphatase 2C negatively regulated by ABL1 is involved in abiotic stress and panicle development in rice.
    Mol. Biotechnol., 2013. 54(2): p. 703-10
    [PMID:23086454]
  5. Guo C,Ge X,Ma H
    The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.
    Plant Mol. Biol., 2013. 82(3): p. 239-53
    [PMID:23686450]
  6. Huang X, et al.
    OsSLI1, a homeodomain containing transcription activator, involves abscisic acid related stress response in rice (Oryza sativa L.).
    ScientificWorldJournal, 2014. 2014: p. 809353
    [PMID:25089296]
  7. Kim N, et al.
    Functional characterization and reconstitution of ABA signaling components using transient gene expression in rice protoplasts.
    Front Plant Sci, 2015. 6: p. 614
    [PMID:26300907]
  8. Chen H, et al.
    Characterization of OsPM19L1 encoding an AWPM-19-like family protein that is dramatically induced by osmotic stress in rice.
    Genet. Mol. Res., 2015. 14(4): p. 11994-2005
    [PMID:26505346]
  9. Tang N, et al.
    MODD Mediates Deactivation and Degradation of OsbZIP46 to Negatively Regulate ABA Signaling and Drought Resistance in Rice.
    Plant Cell, 2016. 28(9): p. 2161-2177
    [PMID:27468891]