PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 69423 | ||||||||
Common Name | SELMODRAFT_49409, SELMODRAFT_69423, SELMODRAFT_69431, WRKY_1, WRKY_14, WRKY_30 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 87aa MW: 10133.5 Da PI: 10.6288 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 105.8 | 2.3e-33 | 30 | 87 | 1 | 58 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 +dDg++WrKYGqK vk+s++prsYYrCt ++Cpvkk+vers edp +v++tYeg+H+h 69423 30 MDDGFRWRKYGQKAVKNSPHPRSYYRCTNSKCPVKKRVERSCEDPGIVITTYEGTHTH 87 69*******************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.3E-35 | 15 | 87 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 4.71E-30 | 22 | 87 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.262 | 25 | 87 | IPR003657 | WRKY domain |
SMART | SM00774 | 6.0E-34 | 30 | 87 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.6E-27 | 31 | 87 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
ASRAKPPKKG PKRNREPRYA LQTRSDVDIM DDGFRWRKYG QKAVKNSPHP RSYYRCTNSK 60 CPVKKRVERS CEDPGIVITT YEGTHTH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 6e-28 | 20 | 87 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 6e-28 | 20 | 87 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002961159.2 | 8e-53 | WRKY transcription factor WRKY24 isoform X2 | ||||
Refseq | XP_002994359.2 | 7e-53 | WRKY transcription factor WRKY24 | ||||
Swissprot | Q9C983 | 6e-38 | WRK57_ARATH; Probable WRKY transcription factor 57 | ||||
TrEMBL | D8QN56 | 4e-58 | D8QN56_SELML; Uncharacterized protein WRKY_14 (Fragment) | ||||
STRING | EFJ04574 | 7e-59 | (Selaginella moellendorffii) | ||||
STRING | EFJ31448 | 7e-59 | (Selaginella moellendorffii) | ||||
STRING | EFJ38698 | 7e-59 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69310.2 | 3e-40 | WRKY DNA-binding protein 57 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 69423 |
Entrez Gene | 9634707 | 9642250 | 9648480 |
Publications ? help Back to Top | |||
---|---|---|---|
|