PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G69310.2 | ||||||||
Common Name | ATWRKY57, F10D13.1, F23O10.11, WRKY57 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 287aa MW: 32042.1 Da PI: 6.7027 | ||||||||
Description | WRKY DNA-binding protein 57 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 105.2 | 3.5e-33 | 147 | 204 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers++dp++v++tYeg+H h+ AT1G69310.2 147 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSRCTVKKRVERSSDDPSIVITTYEGQHCHQ 204 8********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.0E-34 | 131 | 205 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.57E-28 | 138 | 204 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.838 | 141 | 206 | IPR003657 | WRKY domain |
SMART | SM00774 | 6.8E-39 | 146 | 205 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.5E-26 | 147 | 204 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 287 aa Download sequence Send to blast |
MNDPDNPDLS NDDSAWRELT LTAQDSDFFD RDTSNILSDF GWNLHHSSDH PHSLRFDSDL 60 TQTTGVKPTT VTSSCSSSAA VSVAVTSTNN NPSATSSSSE DPAENSTASA EKTPPPETPV 120 KEKKKAQKRI RQPRFAFMTK SDVDNLEDGY RWRKYGQKAV KNSPFPRSYY RCTNSRCTVK 180 KRVERSSDDP SIVITTYEGQ HCHQTIGFPR GGILTAHDPH SFTSHHHLPP PLPNPYYYQE 240 LLHQLHRDNN APSPRLPRPT TEDTPAVSTP SEEGLLGDIV PQTMRNP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-25 | 136 | 203 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-25 | 136 | 203 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 260337_at | 0.0 | ||||
Expression Atlas | AT1G69310 | - | ||||
AtGenExpress | AT1G69310 | - | ||||
ATTED-II | AT1G69310 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | member of WRKY Transcription Factor; Group II-c | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00067 | PBM | 25215497 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G69310.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G69310 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY071849 | 0.0 | AY071849.1 Arabidopsis thaliana WRKY transcription factor 57 (WRKY57) mRNA, complete cds. | |||
GenBank | BT026057 | 0.0 | BT026057.1 Arabidopsis thaliana At1g69310 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001321561.1 | 0.0 | WRKY DNA-binding protein 57 | ||||
Refseq | NP_177090.1 | 0.0 | WRKY DNA-binding protein 57 | ||||
Refseq | NP_974112.1 | 0.0 | WRKY DNA-binding protein 57 | ||||
Swissprot | Q9C983 | 0.0 | WRK57_ARATH; Probable WRKY transcription factor 57 | ||||
TrEMBL | Q147N6 | 0.0 | Q147N6_ARATH; At1g69310 | ||||
STRING | AT1G69310.1 | 0.0 | (Arabidopsis thaliana) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G69310.2 |
Entrez Gene | 843262 |
iHOP | AT1G69310 |
wikigenes | AT1G69310 |