PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 69405 | ||||||||
Common Name | SELMODRAFT_69405, WRKY_24 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 82aa MW: 9852.22 Da PI: 10.7156 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.9 | 8.9e-33 | 25 | 82 | 1 | 58 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 +dDgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers++d ++v++tYeg H+h 69405 25 MDDGYRWRKYGQKAVKNSPYPRSYYRCTYTKCHVKKRVERSSKDSSLVITTYEGVHTH 82 69*******************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.6E-33 | 11 | 82 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.53E-29 | 18 | 82 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.528 | 20 | 82 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.3E-33 | 25 | 82 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.8E-26 | 26 | 82 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
PRRKGKKRSH QPRYAIQTKS DKEIMDDGYR WRKYGQKAVK NSPYPRSYYR CTYTKCHVKK 60 RVERSSKDSS LVITTYEGVH TH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ayd_A | 5e-27 | 13 | 82 | 2 | 71 | WRKY transcription factor 1 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 5 | 9 | KKRSH |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002988797.2 | 3e-51 | probable WRKY transcription factor 23 | ||||
Swissprot | Q9C983 | 3e-36 | WRK57_ARATH; Probable WRKY transcription factor 57 | ||||
TrEMBL | D8R084 | 9e-53 | D8R084_SELML; Uncharacterized protein WRKY_24 (Fragment) | ||||
STRING | EFJ34931 | 1e-53 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69310.2 | 1e-38 | WRKY DNA-binding protein 57 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 69405 |
Entrez Gene | 9654837 |
Publications ? help Back to Top | |||
---|---|---|---|
|