PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 59543
Common NameSELMODRAFT_49502, SELMODRAFT_59543
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family SBP
Protein Properties Length: 74aa    MW: 8821.02 Da    PI: 10.6951
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
59543genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1322.1e-41174275
           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
    SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75
           Cq+egC+adls+ak+yhrrhkvCe hskap+v++++++qrfCqqCsrfh l+efD++krsCr+rLa+hn+rrrk
  59543  1 CQAEGCTADLSKAKHYHRRHKVCELHSKAPNVIANNQTQRFCQQCSRFHLLTEFDDSKRSCRKRLADHNRRRRK 74
           *************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-33162IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.564174IPR004333Transcription factor, SBP-box
PfamPF031105.4E-32174IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-36174IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
CQAEGCTADL SKAKHYHRRH KVCELHSKAP NVIANNQTQR FCQQCSRFHL LTEFDDSKRS  60
CRKRLADHNR RRRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-301741184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269|PubMed:12671094, ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:17093870}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002984272.25e-47la-related protein CG11505
RefseqXP_024545119.15e-47la-related protein CG11505
SwissprotQ8GXL38e-38SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLD8RMG12e-46D8RMG1_SELML; Uncharacterized protein (Fragment)
STRINGEFJ147824e-47(Selaginella moellendorffii)
STRINGEFJ265264e-47(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.13e-40squamosa promoter binding protein-like 8
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  2. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  3. Xing S, et al.
    SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility.
    Plants (Basel), 2013. 2(3): p. 416-28
    [PMID:27137384]