PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 59543 | ||||||||
Common Name | SELMODRAFT_49502, SELMODRAFT_59543 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 74aa MW: 8821.02 Da PI: 10.6951 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 132 | 2.1e-41 | 1 | 74 | 2 | 75 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 Cq+egC+adls+ak+yhrrhkvCe hskap+v++++++qrfCqqCsrfh l+efD++krsCr+rLa+hn+rrrk 59543 1 CQAEGCTADLSKAKHYHRRHKVCELHSKAPNVIANNQTQRFCQQCSRFHLLTEFDDSKRSCRKRLADHNRRRRK 74 *************************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 1.3E-33 | 1 | 62 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.564 | 1 | 74 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 5.4E-32 | 1 | 74 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.44E-36 | 1 | 74 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 74 aa Download sequence Send to blast |
CQAEGCTADL SKAKHYHRRH KVCELHSKAP NVIANNQTQR FCQQCSRFHL LTEFDDSKRS 60 CRKRLADHNR RRRK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-30 | 1 | 74 | 11 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269|PubMed:12671094, ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:17093870}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002984272.2 | 5e-47 | la-related protein CG11505 | ||||
Refseq | XP_024545119.1 | 5e-47 | la-related protein CG11505 | ||||
Swissprot | Q8GXL3 | 8e-38 | SPL8_ARATH; Squamosa promoter-binding-like protein 8 | ||||
TrEMBL | D8RMG1 | 2e-46 | D8RMG1_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ14782 | 4e-47 | (Selaginella moellendorffii) | ||||
STRING | EFJ26526 | 4e-47 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP97 | 17 | 230 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G02065.1 | 3e-40 | squamosa promoter binding protein-like 8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 59543 |
Entrez Gene | 9645024 | 9650586 |
Publications ? help Back to Top | |||
---|---|---|---|
|