PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G02065.1

Common Name

SPL8, T7I23.32

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

SBP

Protein Properties

Length: 333aa MW: 36827.1 Da PI: 8.8865

Description

squamosa promoter binding protein-like 8

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G02065.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	127	7.5e-40	187	264	1	78
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +Cq+egC+adls+ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk ++ AT1G02065.1 187 RCQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKCHQ 264 6*************************************************************************9865 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	7.1E-35	183	249	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	32.223	185	262	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	1.47E-37	186	265	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	4.5E-30	188	261	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009554	Biological Process	megasporogenesis
GO:0009556	Biological Process	microsporogenesis
GO:0030154	Biological Process	cell differentiation
GO:0048653	Biological Process	anther development
GO:0005634	Cellular Component	nucleus
GO:0005737	Cellular Component	cytoplasm
GO:0003677	Molecular Function	DNA binding
GO:0046872	Molecular Function	metal ion binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0009046	anatomy	flower

Sequence ? help Back to Top
Protein Sequence Length: 333 aa Download sequence Send to blast
MLDYEWDNPS SIVLSGDERN PDSDPTRSSF SFFDPISHYN NDHRHITISP PLLSSFSNQQ 60 QQHHLTLYGQ TNSNNQFLHH HHHHHSLYGS TTTTTPYGAS DPIYHPHSSA PPASLFSYDQ 120 TGPGSGSGSS YNFLIPKTEV DFTSNRIGLN LGGRTYFSAA DDDFVSRLYR RSRPGESGMA 180 NSLSTPRCQA EGCNADLSHA KHYHRRHKVC EFHSKASTVV AAGLSQRFCQ QCSRFHLLSE 240 FDNGKRSCRK RLADHNRRRR KCHQSASATQ DTGTGKTTPK SPNDSGVKAS SSPSSNAPPT 300 ISLECFRQRQ FQTTASSSTS ASSSSNSMFF SSG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	1e-30	188	261	11	84	squamosa promoter binding protein-like 4
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.499	0.0	floral meristem\| flower

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	AT1G02065
AtGenExpress	AT1G02065

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed during plant development. During pollen development, required for crosporogenesis that leads to archesporial formation and for the histogenesis of the microsporangia. During ovules development, involved in the transition to meiosis of the megaspore mother cells. {ECO:0000269\|PubMed:10524240, ECO:0000269\|PubMed:12671094}.
Uniprot	TISSUE SPECIFICITY: Expressed in shoot apical region and early floral tissues. Transcripts levels increase in developing pollen sacs, and decrease in later stage of anther development. Strongly expressed in the placental region of the carpels. {ECO:0000269\|PubMed:12671094, ECO:0000269\|PubMed:17093870}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes an SBP-box gene, a member of the SPL gene family. Mutants are affected in micro- and megasporogenesis, trichome formation on sepals, and stamen filament elongation.
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269\|PubMed:12671094, ECO:0000269\|PubMed:16095614, ECO:0000269\|PubMed:17093870}.

Function -- GeneRIF ? help Back to Top
Data demonstrate that miR156 is a quantitative, rather than spatial, modulator of SPL8 expression in leaf primordia and that SPL6 activity nonautonomously inhibits initiation of new leaves at the shoot apical meristem. [PMID: 18492871] SPL8 and miR156-targeted SPL genes control gynoecium patterning through interference with auxin homeostasis and signalling. [PMID: 23621152]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00090	SELEX	26531826	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G02065.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT1G69120

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G02065

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ011642	0.0	AJ011642.1 Arabidopsis thaliana (ecotype Columbia) mRNA for squamosa promoter binding protein-like 8.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_683267.1	0.0	squamosa promoter binding protein-like 8
Swissprot	Q8GXL3	0.0	SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBL	A0A178WH70	0.0	A0A178WH70_ARATH; SPL8
STRING	AT1G02065.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7010	27	43
Representative plant	OGRP97	17	230

Link Out ? help Back to Top
Phytozome	AT1G02065.1
Entrez Gene	839275
iHOP	AT1G02065
wikigenes	AT1G02065

Publications ? help Back to Top
Cardon G, et al. Molecular characterisation of the Arabidopsis SBP-box genes. Gene, 1999. 237(1): p. 91-104 [PMID:10524240] Seki M, et al. Functional annotation of a full-length Arabidopsis cDNA collection. Science, 2002. 296(5565): p. 141-5 [PMID:11910074] Unte US, et al. SPL8, an SBP-box gene that affects pollen sac development in Arabidopsis. Plant Cell, 2003. 15(4): p. 1009-19 [PMID:12671094] Folta KM,Pontin MA,Karlin-Neumann G,Bottini R,Spalding EP Genomic and physiological studies of early cryptochrome 1 action demonstrate roles for auxin and gibberellin in the control of hypocotyl growth by blue light. Plant J., 2003. 36(2): p. 203-14 [PMID:14535885] Albert VA, et al. Floral gene resources from basal angiosperms for comparative genomics research. BMC Plant Biol., 2005. 5: p. 5 [PMID:15799777] Birkenbihl RP,Jach G,Saedler H,Huijser P Functional dissection of the plant-specific SBP-domain: overlap of the DNA-binding and nuclear localization domains. J. Mol. Biol., 2005. 352(3): p. 585-96 [PMID:16095614] Zhang Y,Schwarz S,Saedler H,Huijser P SPL8, a local regulator in a subset of gibberellin-mediated developmental processes in Arabidopsis. Plant Mol. Biol., 2007. 63(3): p. 429-39 [PMID:17093870] Xing S,Zachgo S ROXY1 and ROXY2, two Arabidopsis glutaredoxin genes, are required for anther development. Plant J., 2008. 53(5): p. 790-801 [PMID:18036205] Wang JW,Schwab R,Czech B,Mica E,Weigel D Dual effects of miR156-targeted SPL genes and CYP78A5/KLUH on plastochron length and organ size in Arabidopsis thaliana. Plant Cell, 2008. 20(5): p. 1231-43 [PMID:18492871] Xing S,Salinas M,H miR156-targeted and nontargeted SBP-box transcription factors act in concert to secure male fertility in Arabidopsis. Plant Cell, 2010. 22(12): p. 3935-50 [PMID:21177480] Smaczniak C, et al. Characterization of MADS-domain transcription factor complexes in Arabidopsis flower development. Proc. Natl. Acad. Sci. U.S.A., 2012. 109(5): p. 1560-5 [PMID:22238427] Xing S, et al. SPL8 and miR156-targeted SPL genes redundantly regulate Arabidopsis gynoecium differential patterning. Plant J., 2013. 75(4): p. 566-77 [PMID:23621152] Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Debernardi JM, et al. Post-transcriptional control of GRF transcription factors by microRNA miR396 and GIF co-activator affects leaf size and longevity. Plant J., 2014. 79(3): p. 413-26 [PMID:24888433] Xing S, et al. SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility. Plants (Basel), 2013. 2(3): p. 416-28 [PMID:27137384]