PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 59269 | ||||||||
Common Name | SELMODRAFT_59269 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 122aa MW: 13484.1 Da PI: 9.4116 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 85.9 | 9.4e-27 | 1 | 55 | 12 | 66 |
DUF702 12 GnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaas 66 GnqakkdC+++RCRtCCksr+fdC+thvkstWvpaa+rr+r ++++a s 59269 1 GNQAKKDCQFQRCRTCCKSRSFDCQTHVKSTWVPAAHRRNRGAAAHAGGDAMIDS 55 9****************************************77766654444333 PP | |||||||
2 | DUF702 | 82.7 | 9.3e-26 | 63 | 121 | 93 | 151 |
DUF702 93 saeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqG 151 s+ ++++ + +P+ev+++avfrcv+++sv+dge+e+aYqt+v igGh+fkG+L+d+G 59269 63 SGLPRSKRARAAFPAEVRAQAVFRCVKLTSVEDGEDEYAYQTTVRIGGHIFKGVLHDRG 121 445555666677*********************************************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 4.1E-46 | 1 | 121 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01623 | 5.4E-24 | 1 | 38 | IPR006510 | Zinc finger, lateral root primordium type 1 |
TIGRFAMs | TIGR01624 | 2.9E-28 | 74 | 122 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
GNQAKKDCQF QRCRTCCKSR SFDCQTHVKS TWVPAAHRRN RGAAAHAGGD AMIDSSSYDH 60 ESSGLPRSKR ARAAFPAEVR AQAVFRCVKL TSVEDGEDEY AYQTTVRIGG HIFKGVLHDR 120 GI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:16740146}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024402502.1 | 5e-43 | protein LATERAL ROOT PRIMORDIUM 1-like isoform X2 | ||||
Refseq | XP_024534506.1 | 3e-42 | AT-rich interactive domain-containing protein 1B-like, partial | ||||
Swissprot | Q9SJT8 | 2e-39 | SRS3_ARATH; Protein SHI RELATED SEQUENCE 3 | ||||
TrEMBL | D8S5N9 | 2e-85 | D8S5N9_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ20090 | 3e-86 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP1313 | 15 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G21400.1 | 1e-39 | SHI-related sequence3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 59269 |
Entrez Gene | 9653861 |
Publications ? help Back to Top | |||
---|---|---|---|
|