PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 39516 | ||||||||
Common Name | MYB4B-1, MYB4B-2, SELMODRAFT_39507, SELMODRAFT_39516 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 87aa MW: 9962.54 Da PI: 9.5152 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54 | 3.9e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd+ll + + ++G g+W+t ++ g++R++k+c++rw +yl 39516 14 RGPWTREEDLLLTQHISLHGEGSWRTLPKAAGLRRCGKSCRLRWINYL 61 89********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.5E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.858 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 1.3E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.1E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.12E-22 | 15 | 87 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.65E-9 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.7E-8 | 65 | 87 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 8.772 | 66 | 87 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MGRAPCCEKV GLNRGPWTRE EDLLLTQHIS LHGEGSWRTL PKAAGLRRCG KSCRLRWINY 60 LRPDLKRGNI SEEEDQLIIK LHSLLGN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-16 | 12 | 87 | 25 | 99 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18541146, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002961794.2 | 4e-56 | transcription factor MYB86 isoform X2 | ||||
Swissprot | Q9S9K9 | 2e-44 | MYB3_ARATH; Transcription factor MYB3 | ||||
TrEMBL | D8QT48 | 3e-56 | D8QT48_SELML; Uncharacterized protein MYB4B-1 (Fragment) | ||||
STRING | EFJ33705 | 4e-57 | (Selaginella moellendorffii) | ||||
STRING | EFJ37054 | 4e-57 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G22640.1 | 1e-46 | myb domain protein 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 39516 |
Entrez Gene | 9629124 | 9658845 |