| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 59.7 | 6.2e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd+llvd+++++G g+W++ +r g+ R++k+c++rw +yl
AT1G22640.1 14 KGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNYL 61
79********************************************97 PP
|
| 2 | Myb_DNA-binding | 60.1 | 4.7e-19 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
AT1G22640.1 67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
89********************.*********.************97 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter |
| GO:0009611 | Biological Process | response to wounding |
| GO:0009651 | Biological Process | response to salt stress |
| GO:0009737 | Biological Process | response to abscisic acid |
| GO:0009751 | Biological Process | response to salicylic acid |
| GO:0009800 | Biological Process | cinnamic acid biosynthetic process |
| GO:0009892 | Biological Process | negative regulation of metabolic process |
| GO:0030154 | Biological Process | cell differentiation |
| GO:0005634 | Cellular Component | nucleus |
| GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding |
| GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
| Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
Science, 2000. 290(5499): p. 2105-10
[PMID:11118137] - Stracke R,Werber M,Weisshaar B
The R2R3-MYB gene family in Arabidopsis thaliana.
Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
[PMID:11597504] - Cheong YH, et al.
Transcriptional profiling reveals novel interactions between wounding, pathogen, abiotic stress, and hormonal responses in Arabidopsis.
Plant Physiol., 2002. 129(2): p. 661-77
[PMID:12068110] - R
Rapid identification of Arabidopsis insertion mutants by non-radioactive detection of T-DNA tagged genes.
Plant J., 2002. 32(2): p. 243-53
[PMID:12383089] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome.
Science, 2003. 302(5646): p. 842-6
[PMID:14593172] - Tepperman JM, et al.
Expression profiling of phyB mutant demonstrates substantial contribution of other phytochromes to red-light-regulated gene expression during seedling de-etiolation.
Plant J., 2004. 38(5): p. 725-39
[PMID:15144375] - De Paepe A,Vuylsteke M,Van Hummelen P,Zabeau M,Van Der Straeten D
Transcriptional profiling by cDNA-AFLP and microarray analysis reveals novel insights into the early response to ethylene in Arabidopsis.
Plant J., 2004. 39(4): p. 537-59
[PMID:15272873] - Rogers LA, et al.
Comparison of lignin deposition in three ectopic lignification mutants.
New Phytol., 2005. 168(1): p. 123-40
[PMID:16159327] - Coupe SA, et al.
Systemic signalling of environmental cues in Arabidopsis leaves.
J. Exp. Bot., 2006. 57(2): p. 329-41
[PMID:16330523] - Yanhui C, et al.
The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
Plant Mol. Biol., 2006. 60(1): p. 107-24
[PMID:16463103] - Mandaokar A, et al.
Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
Plant J., 2006. 46(6): p. 984-1008
[PMID:16805732] - Cao D,Cheng H,Wu W,Soo HM,Peng J
Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
Plant Physiol., 2006. 142(2): p. 509-25
[PMID:16920880] - Goeres DC, et al.
Components of the Arabidopsis mRNA decapping complex are required for early seedling development.
Plant Cell, 2007. 19(5): p. 1549-64
[PMID:17513503] - Dubos C, et al.
MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana.
Plant J., 2008. 55(6): p. 940-53
[PMID:18532978] - Bang WY,Kim SW,Jeong IS,Koiwa H,Bahk JD
The C-terminal region (640-967) of Arabidopsis CPL1 interacts with the abiotic stress- and ABA-responsive transcription factors.
Biochem. Biophys. Res. Commun., 2008. 372(4): p. 907-12
[PMID:18541146] - Agudelo-Romero P, et al.
Changes in the gene expression profile of Arabidopsis thaliana after infection with Tobacco etch virus.
Virol. J., 2008. 5: p. 92
[PMID:18684336] - Rowan DD, et al.
Environmental regulation of leaf colour in red 35S:PAP1 Arabidopsis thaliana.
New Phytol., 2009. 182(1): p. 102-15
[PMID:19192188] - Arabidopsis Interactome Mapping Consortium
Evidence for network evolution in an Arabidopsis interactome map.
Science, 2011. 333(6042): p. 601-7
[PMID:21798944] - Tominaga-Wada R,Nukumizu Y
Expression analysis of an R3-Type MYB transcription factor CPC-LIKE MYB4 (TRICHOMELESS2) and CPL4-Related transcripts in Arabidopsis.
Int J Mol Sci, 2012. 13(3): p. 3478-91
[PMID:22489163] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
Mol. Biol. Evol., 2015. 32(7): p. 1767-73
[PMID:25750178] - Zhou M, et al.
Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis.
Plant J., 2015. 84(2): p. 395-403
[PMID:26332741] - Wada T,Hayashi N,Tominaga-Wada R
Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis.
Plant Signal Behav, 2015. 10(11): p. e1089372
[PMID:26339713] - Wada T,Tominaga-Wada R
CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression.
Plant Sci., 2015. 241: p. 260-5
[PMID:26706076] - Song L, et al.
A transcription factor hierarchy defines an environmental stress response network.
Science, 2017.
[PMID:27811239] - Zhou M, et al.
LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis.
Plant Physiol., 2017. 174(3): p. 1348-1358
[PMID:28483877] - Mondal SK,Roy S
Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
[PMID:28490275] - Kranz HD, et al.
Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
Plant J., 1998. 16(2): p. 263-76
[PMID:9839469]
|
