PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 37169 | ||||||||
Common Name | SELMODRAFT_26920, SELMODRAFT_37169 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 119aa MW: 13138 Da PI: 8.2136 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 139 | 1.6e-43 | 6 | 106 | 1 | 101 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101 +CaaCk+lrr+Ca++C++apyf ++p+kfa+vhk+FGasnv+k+l+++pe +r+d+++slvyeA+ar+rdPvyG++g+i++lqqq ++l+ae+++++e++ 37169 6 PCAACKLLRRRCAQECPFAPYFSPHEPQKFAAVHKVFGASNVSKMLSEVPEAQRSDVANSLVYEANARIRDPVYGCTGTISALQQQAQSLQAEVNAMREQI 106 7***********************************************************************************************99885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 25.728 | 5 | 106 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.6E-43 | 6 | 103 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016020 | Cellular Component | membrane |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
LNTITPCAAC KLLRRRCAQE CPFAPYFSPH EPQKFAAVHK VFGASNVSKM LSEVPEAQRS 60 DVANSLVYEA NARIRDPVYG CTGTISALQQ QAQSLQAEVN AMREQIMRYQ VHENAVAAV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 8e-46 | 6 | 113 | 11 | 118 | LOB family transfactor Ramosa2.1 |
5ly0_B | 8e-46 | 6 | 113 | 11 | 118 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00283 | DAP | Transfer from AT2G30340 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002962437.2 | 4e-83 | LOB domain-containing protein 15 | ||||
Refseq | XP_002989392.2 | 5e-83 | LOB domain-containing protein 15 | ||||
Swissprot | Q9AT61 | 2e-60 | LBD13_ARATH; LOB domain-containing protein 13 | ||||
TrEMBL | D8QUM8 | 1e-82 | D8QUM8_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ09483 | 2e-83 | (Selaginella moellendorffii) | ||||
STRING | EFJ35900 | 2e-83 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP60 | 16 | 318 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G40470.1 | 8e-58 | LOB domain-containing protein 15 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 37169 |
Entrez Gene | 9650735 | 9660801 |
Publications ? help Back to Top | |||
---|---|---|---|
|