PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

29247

Common Name

SELMODRAFT_18136, WRKY_29

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

WRKY

Protein Properties

Length: 80aa MW: 9539.81 Da PI: 10.4529

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
29247	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	106.2	1.7e-33	23	80	1	58
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 +dDgy+WrKYGqK vk+s++prsYYrCt ++Cpvkk+vers+ed+ +v++tYeg Hnh 29247 23 MDDGYRWRKYGQKAVKNSPHPRSYYRCTNTKCPVKKRVERSSEDQGLVITTYEGIHNH 80 69*******************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.0E-35	8	80	IPR003657	WRKY domain
SuperFamily	SSF118290	2.75E-30	15	80	IPR003657	WRKY domain
PROSITE profile	PS50811	31.054	18	80	IPR003657	WRKY domain
SMART	SM00774	1.0E-34	23	80	IPR003657	WRKY domain
Pfam	PF03106	4.4E-27	24	80	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009414	Biological Process	response to water deprivation
GO:0009651	Biological Process	response to salt stress
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 80 aa Download sequence Send to blast
KKGQKRIREP RYAIQTRSEV DIMDDGYRWR KYGQKAVKNS PHPRSYYRCT NTKCPVKKRV 60 ERSSEDQGLV ITTYEGIHNH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2ayd_A	1e-29	11	80	2	71	WRKY transcription factor 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00067	PBM	Transfer from AT1G69310	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002972266.2	1e-47	probable WRKY transcription factor 23 isoform X2
Refseq	XP_002984180.2	1e-47	probable WRKY transcription factor 23 isoform X1
Refseq	XP_024532948.1	1e-47	probable WRKY transcription factor 23 isoform X1
Refseq	XP_024545124.1	1e-47	probable WRKY transcription factor 23 isoform X2
Swissprot	Q9C983	6e-39	WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBL	D8SLN2	1e-52	D8SLN2_SELML; Uncharacterized protein WRKY_29 (Fragment)
STRING	EFJ14690	2e-53	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP14	17	875

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69310.2	2e-41	WRKY DNA-binding protein 57

Link Out ? help Back to Top
Phytozome	29247
Entrez Gene	9645041

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Jiang Y,Qiu Y,Hu Y,Yu D Heterologous Expression of AtWRKY57 Confers Drought Tolerance in Oryza sativa. Front Plant Sci, 2016. 7: p. 145 [PMID:26904091] Jiang Y,Yu D The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance. Plant Physiol., 2016. 171(4): p. 2771-82 [PMID:27268959] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615]