PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 133546 | ||||||||
Common Name | SELMODRAFT_133546, SELMODRAFT_137652 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 176aa MW: 19287.8 Da PI: 11.5616 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 37.7 | 4.8e-12 | 99 | 143 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +W +eE+ l++ + + lG+g+W+ I+r + Rt+ q+ s+ qky 133546 99 PWREEEHRLFLVGLHALGKGDWRGISRNYVTSRTPTQVASHAQKY 143 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50158 | 9.125 | 3 | 20 | IPR001878 | Zinc finger, CCHC-type |
Gene3D | G3DSA:4.10.60.10 | 9.2E-5 | 3 | 21 | IPR001878 | Zinc finger, CCHC-type |
PROSITE profile | PS51294 | 16.669 | 92 | 148 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.41E-16 | 93 | 149 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.4E-16 | 95 | 147 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 4.8E-9 | 96 | 142 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.4E-9 | 96 | 146 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-9 | 99 | 143 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.49E-8 | 99 | 144 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MARRCSHCGH NGHNSRTCPD RGIRLFGVRL TMKATDGASG VAMRRSASAG NLVTMQAIAT 60 PTSSSAVASE QSESGGDGYA SDGLVQASSY ARARKKGVPW REEEHRLFLV GLHALGKGDW 120 RGISRNYVTS RTPTQVASHA QKYFIRQSNL TKRKRRSSLF DISPEVRRSI HLFFH* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024523230.1 | 1e-120 | transcription factor MYBS3 isoform X2 | ||||
Swissprot | Q7XC57 | 1e-71 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
TrEMBL | D8T774 | 1e-126 | D8T774_SELML; Uncharacterized protein | ||||
STRING | EFJ05081 | 1e-127 | (Selaginella moellendorffii) | ||||
STRING | EFJ07570 | 1e-127 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP394 | 16 | 99 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47390.1 | 1e-67 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 133546 |
Entrez Gene | 9639118 | 9639572 |
Publications ? help Back to Top | |||
---|---|---|---|
|