PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00029285-RA_Salv | ||||||||
Common Name | WRKY43 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 176aa MW: 19730.8 Da PI: 5.6453 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 99 | 2.9e-31 | 113 | 171 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YYrC+ +gCpvkk+ver++edp +v++tYeg Hnh+ SMil_00029285-RA_Salv 113 LDDGFKWRKYGKKMVKNSPNPRNYYRCSVEGCPVKKRVERDNEDPLYVVTTYEGIHNHK 171 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.5E-33 | 99 | 173 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.09E-28 | 106 | 173 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.71 | 108 | 173 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.4E-37 | 113 | 172 | IPR003657 | WRKY domain |
Pfam | PF03106 | 8.7E-25 | 114 | 171 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MDAPLMIMAD DHSYPIKPGS SLGQAHEPGF EVSDFFEFND WIEEAPSFSS PLSAASYDSQ 60 NPSYTPNAGS SWSSSSSSSS FLEGAITRDS GCGREKEMRE KVAFKTKSEV EVLDDGFKWR 120 KYGKKMVKNS PNPRNYYRCS VEGCPVKKRV ERDNEDPLYV VTTYEGIHNH KGPHQV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-25 | 103 | 173 | 7 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 1e-25 | 103 | 173 | 7 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM823166 | 0.0 | KM823166.1 Salvia miltiorrhiza WRKY protein (WRKY43) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011100937.1 | 2e-73 | probable WRKY transcription factor 50 | ||||
TrEMBL | A0A0D5Y9A9 | 1e-117 | A0A0D5Y9A9_SALMI; WRKY protein | ||||
STRING | Migut.E01579.1.p | 3e-68 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2124 | 24 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 4e-42 | WRKY DNA-binding protein 50 |