PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00021683-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 182aa MW: 21293.2 Da PI: 10.6453 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.8 | 5.1e-18 | 18 | 63 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v ++G+ +W++Ia++++ gR++k+c++rw++ SMil_00021683-RA_Salv 18 RGHWRPAEDEKLRQLVDKYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 63 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 58.9 | 1.1e-18 | 70 | 113 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++++eE+e+l+ a++ +G++ W++I+r ++ gRt++ +k++w+ SMil_00021683-RA_Salv 70 RRPFSEEEEERLLAAHRIHGNK-WALISRLFP-GRTDNAVKNHWHV 113 679*******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.872 | 13 | 64 | IPR017930 | Myb domain |
SMART | SM00717 | 1.8E-14 | 17 | 66 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 8.99E-30 | 17 | 111 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.2E-17 | 18 | 63 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-27 | 19 | 71 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.74E-13 | 21 | 62 | No hit | No description |
PROSITE profile | PS51294 | 27.388 | 65 | 119 | IPR017930 | Myb domain |
SMART | SM00717 | 1.2E-15 | 69 | 117 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-15 | 70 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.8E-21 | 72 | 118 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.02E-7 | 81 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 182 aa Download sequence Send to blast |
MDESRCRGSN DDPRTCPRGH WRPAEDEKLR QLVDKYGPQN WNSIAEKLQG RSGKSCRLRW 60 FNQLDPRINR RPFSEEEEER LLAAHRIHGN KWALISRLFP GRTDNAVKNH WHVIMARKQR 120 EKSKLCGKIR AHNQDLNALI MDSKSPTNYT KTRTRTRTIA EEKSMEKKDV PFIDFLGVGI 180 SS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-32 | 18 | 118 | 7 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF059459 | 0.0 | KF059459.1 Salvia miltiorrhiza MYB-related transcription factor (MYB105) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011101908.1 | 2e-86 | transcription factor MYB27 | ||||
Refseq | XP_020554996.1 | 2e-86 | transcription factor MYB27 | ||||
Swissprot | Q6R0C4 | 2e-66 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | A0A059PRX5 | 1e-105 | A0A059PRX5_SALMI; MYB-related transcription factor | ||||
STRING | XP_009769218.1 | 3e-79 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1784 | 24 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17950.1 | 2e-64 | myb domain protein 52 |
Publications ? help Back to Top | |||
---|---|---|---|
|