PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00019995-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family GRAS
Protein Properties Length: 441aa    MW: 48523.6 Da    PI: 5.9368
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00019995-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS456.61.5e-139684331374
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            lv++L++cAeav++++++la+al++++  la +++ +m+++a+yf+eALa+r+++    ly    p ++++  s+ +   +  f+e++
  SMil_00019995-RA_Salv  68 LVHTLMACAEAVQQENFKLAEALVKNIGFLAVSQAGAMRKVATYFAEALARRIYK----LY----PANQQD--SAFNDLLQMHFYETC 145
                            689***************************************************9....44....444433..4444445556***** PP

                   GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                            P+lkf+h+taNqaIlea++g++rvH+iDf+++qG+QWpaLlqaLa Rp+gpps+R+Tg+g+p++++++ l+e+g+rLa++Ae+++v+f
  SMil_00019995-RA_Salv 146 PYLKFAHFTANQAILEAFAGKSRVHVIDFSMKQGMQWPALLQALALRPGGPPSFRLTGIGPPSHDETDHLQEVGWRLAQLAESINVEF 233
                            **************************************************************************************** PP

                   GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                            e++ +va++l+dl+  ++++++gE++aVn++++lh+ll++++++e+    vL++v +l+P++++vveqea+hn++ F++rf+e+l+yy
  SMil_00019995-RA_Salv 234 EYRGFVASSLADLDAAMFDIREGETVAVNSIFELHQLLARPGAIEK----VLQVVSGLKPEILTVVEQEANHNGAMFMDRFTESLHYY 317
                            **********************************************....************************************** PP

                   GRAS 265 salfdsleak.....lpres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                            s+lfdsle+         e+   +++++++++lgr+i+nvvaceg +r+erhetl++W+ r+++aGF+pv+l+++a+kqa++ll+ ++
  SMil_00019995-RA_Salv 318 STLFDSLESCgggggE--EAvsVQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWKTRFGSAGFEPVHLGSNAYKQASMLLALFA 403
                            *******876343322..224489999************************************************************* PP

                   GRAS 346 .sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                             +dgyrv+e++g+l+lgW++rpL+++SaW+
  SMil_00019995-RA_Salv 404 gGDGYRVDENNGCLMLGWHTRPLIATSAWK 433
                            *****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.91242412IPR005202Transcription factor GRAS
PfamPF035145.2E-13768433IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MPVDLDFGSD LIAIPGKAVY PRTQPQEPQP KKLKTCPYSI AALPVPVPVP PPATPLLLVD  60
SQENGIRLVH TLMACAEAVQ QENFKLAEAL VKNIGFLAVS QAGAMRKVAT YFAEALARRI  120
YKLYPANQQD SAFNDLLQMH FYETCPYLKF AHFTANQAIL EAFAGKSRVH VIDFSMKQGM  180
QWPALLQALA LRPGGPPSFR LTGIGPPSHD ETDHLQEVGW RLAQLAESIN VEFEYRGFVA  240
SSLADLDAAM FDIREGETVA VNSIFELHQL LARPGAIEKV LQVVSGLKPE ILTVVEQEAN  300
HNGAMFMDRF TESLHYYSTL FDSLESCGGG GGEEAVSVQD KVMSEVYLGR QICNVVACEG  360
VDRVERHETL AQWKTRFGSA GFEPVHLGSN AYKQASMLLA LFAGGDGYRV DENNGCLMLG  420
WHTRPLIATS AWKLTGLTRQ R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-676343214378Protein SCARECROW
5b3h_A3e-676343213377Protein SCARECROW
5b3h_D3e-676343213377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070609.10.0DELLA protein GAI1
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A4D9BQN20.0A0A4D9BQN2_SALSN; DELLA protein
STRINGMigut.E00445.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein