PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00008992-RA_Salv | ||||||||
Common Name | MYB36 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 152aa MW: 17254.6 Da PI: 7.4158 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.1 | 2e-18 | 9 | 56 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+ +Ed l+++v+++G+++Wk++a + g++R++k+c++rw++yl SMil_00008992-RA_Salv 9 KGAWSVDEDTTLAQYVALHGPKRWKSVAIKSGLNRCGKSCRLRWLNYL 56 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 28.9 | 2.6e-09 | 75 | 98 | 23 | 47 |
-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 23 tWktIartmgkgRtlkqcksrwqky 47 +W++Ia++++ gRt++++k++w+ + SMil_00008992-RA_Salv 75 RWSLIAKRIP-GRTDNEIKNYWNAH 98 5*********.***********977 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 25.011 | 4 | 60 | IPR017930 | Myb domain |
SMART | SM00717 | 2.6E-14 | 8 | 58 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.49E-24 | 9 | 100 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.2E-17 | 9 | 56 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.0E-22 | 10 | 63 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.55E-10 | 11 | 56 | No hit | No description |
SMART | SM00717 | 2.2E-5 | 61 | 101 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 11.477 | 61 | 103 | IPR017930 | Myb domain |
CDD | cd00167 | 2.75E-7 | 64 | 99 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.7E-16 | 64 | 102 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.1E-7 | 75 | 99 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 152 aa Download sequence Send to blast |
MASDASLNKG AWSVDEDTTL AQYVALHGPK RWKSVAIKSG LNRCGKSCRL RWLNYLRPDI 60 KRGNFSDAEE DLILRWSLIA KRIPGRTDNE IKNYWNAHLR KKAMLMDKLP AISTAAMKQN 120 IWNETGGDDE SLDVSASGLD WVKSFLELDE DE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 5e-25 | 4 | 103 | 22 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15668208, ECO:0000269|PubMed:15728674}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF059500 | 1e-127 | KF059500.1 Salvia miltiorrhiza MYB-related transcription factor (MYB36) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011081404.2 | 1e-69 | transcription factor WER-like | ||||
Swissprot | Q96276 | 1e-43 | MYB23_ARATH; Transcription factor MYB23 | ||||
TrEMBL | A0A059PRJ2 | 1e-103 | A0A059PRJ2_SALMI; MYB-related transcription factor | ||||
STRING | Migut.A01129.1.p | 1e-58 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G40330.1 | 5e-46 | myb domain protein 23 |
Publications ? help Back to Top | |||
---|---|---|---|
|