| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 58.2 | 1.9e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g WT eEd++l d+v+ +G g+W++Ia++ g++R++k+c++rw +yl
AT5G40330.1 14 KGLWTVEEDKILMDYVRTHGQGHWNRIAKKTGLKRCGKSCRLRWMNYL 61
678*******************************************97 PP
|
| 2 | Myb_DNA-binding | 60.3 | 4.2e-19 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg++T +E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
AT5G40330.1 67 RGNFTDQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 112
89********************.*********.************996 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| TAIR | Encodes a MYB gene that, when overexpressed ectopically, can induce ectopic trichome formation. It is a member of subgroup 15, together with WER and GL1. Members of this subgroup share a conserved motif of 19 amino acids in the putative transcription activation domain at the C-terminal end. The gene is expressed in leaves, stems, flowers, seeds and roots and quite strongly in trichomes. There is partial functional redundancy between ATMYB23 and GL1. The two proteins are functionally equivalent with respect to the regulation of trichome initiation but not with respect to trichome branching - which is controlled by MYB23 and not GL1. |
| UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15668208, ECO:0000269|PubMed:15728674}. |
| Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
Science, 2000. 290(5499): p. 2105-10
[PMID:11118137] - Kirik V, et al.
Ectopic expression of the Arabidopsis AtMYB23 gene induces differentiation of trichome cells.
Dev. Biol., 2001. 235(2): p. 366-77
[PMID:11437443] - Stracke R,Werber M,Weisshaar B
The R2R3-MYB gene family in Arabidopsis thaliana.
Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
[PMID:11597504] - Abe H, et al.
Arabidopsis AtMYC2 (bHLH) and AtMYB2 (MYB) function as transcriptional activators in abscisic acid signaling.
Plant Cell, 2003. 15(1): p. 63-78
[PMID:12509522] - Hiratsu K,Matsui K,Koyama T,Ohme-Takagi M
Dominant repression of target genes by chimeric repressors that include the EAR motif, a repression domain, in Arabidopsis.
Plant J., 2003. 34(5): p. 733-9
[PMID:12787253] - Baudry A, et al.
TT2, TT8, and TTG1 synergistically specify the expression of BANYULS and proanthocyanidin biosynthesis in Arabidopsis thaliana.
Plant J., 2004. 39(3): p. 366-80
[PMID:15255866] - Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF
Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins.
Plant J., 2004. 40(1): p. 22-34
[PMID:15361138] - Matsui K,Hiratsu K,Koyama T,Tanaka H,Ohme-Takagi M
A chimeric AtMYB23 repressor induces hairy roots, elongation of leaves and stems, and inhibition of the deposition of mucilage on seed coats in Arabidopsis.
Plant Cell Physiol., 2005. 46(1): p. 147-55
[PMID:15668208] - Kirik V, et al.
Functional diversification of MYB23 and GL1 genes in trichome morphogenesis and initiation.
Development, 2005. 132(7): p. 1477-85
[PMID:15728674] - Yanhui C, et al.
The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
Plant Mol. Biol., 2006. 60(1): p. 107-24
[PMID:16463103] - Gao Y, et al.
SAD2 in Arabidopsis functions in trichome initiation through mediating GL3 function and regulating GL1, TTG1 and GL2 expression.
J Integr Plant Biol, 2008. 50(7): p. 906-17
[PMID:18713401] - Jakoby MJ, et al.
Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.
Plant Physiol., 2008. 148(3): p. 1583-602
[PMID:18805951] - Li SF, et al.
The Arabidopsis MYB5 transcription factor regulates mucilage synthesis, seed coat development, and trichome morphogenesis.
Plant Cell, 2009. 21(1): p. 72-89
[PMID:19136646] - Kang YH, et al.
The MYB23 gene provides a positive feedback loop for cell fate specification in the Arabidopsis root epidermis.
Plant Cell, 2009. 21(4): p. 1080-94
[PMID:19395683] - Marks MD,Wenger JP,Gilding E,Jilk R,Dixon RA
Transcriptome analysis of Arabidopsis wild-type and gl3-sst sim trichomes identifies four additional genes required for trichome development.
Mol Plant, 2009. 2(4): p. 803-22
[PMID:19626137] - Van Minnebruggen A, et al.
The ang3 mutation identified the ribosomal protein gene RPL5B with a role in cell expansion during organ growth.
Physiol Plant, 2010. 138(1): p. 91-101
[PMID:19878482] - Schliep M,Ebert B,Simon-Rosin U,Zoeller D,Fisahn J
Quantitative expression analysis of selected transcription factors in pavement, basal and trichome cells of mature leaves from Arabidopsis thaliana.
Protoplasma, 2010. 241(1-4): p. 29-36
[PMID:20101514] - Tominaga-Wada R, et al.
Functional divergence of MYB-related genes, WEREWOLF and AtMYB23 in Arabidopsis.
Biosci. Biotechnol. Biochem., 2012. 76(5): p. 883-7
[PMID:22738953] - Khosla A, et al.
HD-Zip Proteins GL2 and HDG11 Have Redundant Functions in Arabidopsis Trichomes, and GL2 Activates a Positive Feedback Loop via MYB23.
Plant Cell, 2014. 26(5): p. 2184-2200
[PMID:24824485] - Yu D, et al.
RPN1a, a subunit of the 26S proteasome, controls trichome development in Arabidopsis.
Plant Physiol. Biochem., 2015. 88: p. 82-8
[PMID:25676129] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
Mol. Biol. Evol., 2015. 32(7): p. 1767-73
[PMID:25750178] - Lung SC, et al.
Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors.
New Phytol., 2018. 218(1): p. 183-200
[PMID:29288621] - Kohanová J, et al.
Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots.
Ann. Bot., 2018. 122(5): p. 903-914
[PMID:29394308]
|
