![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SMil_00007824-RA_Salv | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 172aa MW: 18839.2 Da PI: 9.2675 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.5 | 1.5e-18 | 38 | 85 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT Ed +lv++v+++G g+W+++ ++ g+ R++k+c++rw ++l SMil_00007824-RA_Salv 38 KGPWTSAEDAILVEYVTKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 85 79******************************************9996 PP | |||||||
2 | Myb_DNA-binding | 26.1 | 1.9e-08 | 91 | 119 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30 +g++T+eE+ +++++++++G++ W++ a++ SMil_00007824-RA_Salv 91 KGAFTPEEERRIIELHAKMGNK-WARMAAE 119 799*******************.***9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.771 | 33 | 89 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.1E-24 | 35 | 88 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-13 | 37 | 87 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.0E-16 | 38 | 85 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.27E-25 | 39 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.69E-11 | 40 | 85 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 8.5E-15 | 89 | 121 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 0.14 | 90 | 156 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 8.172 | 90 | 142 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.9E-7 | 91 | 120 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 0.00137 | 93 | 120 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MRMSSESDER TKPNSGVDSP SVDDGIEGNV GGNGPLKKGP WTSAEDAILV EYVTKHGEGN 60 WNAVQKHSGL ARCGKSCRLR WANHLRPDLK KGAFTPEEER RIIELHAKMG NKWARMAAEF 120 MSHADASSTA ASAWRSSNPL KTASEAAPQF IKQIRTPQLT EAIEAVARNL FP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-21 | 33 | 137 | 22 | 123 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. May bind to the 5'-TAACAAA-3' box of alpha-amylase promoter. {ECO:0000269|PubMed:9150608}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By gibberellin in aleurone cells. {ECO:0000269|PubMed:9150608}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF059432 | 0.0 | KF059432.1 Salvia miltiorrhiza MYB-related transcription factor (MYB78) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011080497.1 | 1e-67 | transcription factor GAMYB-like isoform X1 | ||||
Refseq | XP_011080498.1 | 9e-68 | transcription factor GAMYB-like isoform X2 | ||||
Refseq | XP_011080499.1 | 9e-68 | transcription factor GAMYB-like isoform X2 | ||||
Refseq | XP_020549969.1 | 9e-68 | transcription factor GAMYB-like isoform X2 | ||||
Swissprot | A2WW87 | 4e-54 | GAM1_ORYSI; Transcription factor GAMYB | ||||
TrEMBL | A0A059PSR6 | 5e-80 | A0A059PSR6_SALMI; MYB-related transcription factor | ||||
STRING | Migut.N02411.1.p | 2e-64 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2021 | 23 | 58 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G32460.2 | 1e-48 | myb domain protein 101 |