PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_02878.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family HB-other
Protein Properties Length: 317aa    MW: 35404.3 Da    PI: 6.6789
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_02878.1_g00009.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.22.5e-1765120257
                              T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                 Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                              +kR   t+ q+e+Le+l+e+++yp+ e +++LA++ gLte+q++ WF+ rR k+k+
  Sme2.5_02878.1_g00009.1  65 SKRIIKTRAQVEALEKLYEEHKYPTDELKADLAESSGLTEKQISGWFCHRRLKDKR 120
                              589999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-1950120IPR009057Homeodomain-like
SuperFamilySSF466895.56E-1656121IPR009057Homeodomain-like
PROSITE profilePS5007115.9261121IPR001356Homeobox domain
SMARTSM003898.4E-1763125IPR001356Homeobox domain
PfamPF000467.7E-1566120IPR001356Homeobox domain
CDDcd000869.25E-1666120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEQLRKTLVQ EALVESSETT LEIGLEGLAT RSLDHPSYGG TPNLSEVHPK DEHFKDDKGH  60
PEKNSKRIIK TRAQVEALEK LYEEHKYPTD ELKADLAESS GLTEKQISGW FCHRRLKDKR  120
LSNGEIYVNG RQDRSSGVIQ DHGSGFRQDS CGSTKQADDK KFDHREVESR RLTGPEFSTA  180
DVACEVGTHF RGKSNCMDDD SSRSSSSLRN ECFSQNAEPY DIATSRYISQ SLPTDFKGVK  240
PKNGPSGYLK VKGQVENSAI TAVKRQLGRH YRLDGPPLGI EFDPLPPGAF ESSMRNPVNG  300
EVNFFLFNVP VIQIQAS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755230.0HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006362312.11e-162PREDICTED: uncharacterized protein LOC102578174
TrEMBLA0A0V0IME61e-163A0A0V0IME6_SOLCH; Putative ovule protein
STRINGPGSC0003DMT4000802671e-161(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34362242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.13e-68HB-other family protein