| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | WRKY | 104.7 | 5e-33 | 198 | 255 | 2 | 60 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60
+DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkver+ d++++ei+Y+g+Hnh+k
Sme2.5_02587.1_g00015.1 198 EDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERNL-DGHITEIVYKGSHNHPK 255
8****************************************.***************85 PP
|
| 2 | WRKY | 106.1 | 1.8e-33 | 362 | 420 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
Sme2.5_02587.1_g00015.1 362 LDDGYRWRKYGQKVVKGNPNPRSYYKCTFTGCPVRKHVERASHDLRAVITTYEGKHNHD 420
59********************************************************7 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0009409 | Biological Process | response to cold |
| GO:0009414 | Biological Process | response to water deprivation |
| GO:0009651 | Biological Process | response to salt stress |
| GO:0010120 | Biological Process | camalexin biosynthetic process |
| GO:0010200 | Biological Process | response to chitin |
| GO:0010508 | Biological Process | positive regulation of autophagy |
| GO:0042742 | Biological Process | defense response to bacterium |
| GO:0050832 | Biological Process | defense response to fungus |
| GO:0070370 | Biological Process | cellular heat acclimation |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription activator (PubMed:26025535). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (PubMed:19199048, PubMed:26025535). Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (PubMed:15618416, PubMed:19199048, PubMed:26025535). {ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048, ECO:0000269|PubMed:26025535}. |
| UniProt | Transcription factor. Interacts specifically with the W box (5'-TTGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Involved in defense responses. Required for resistance to the necrotrophic fungal pathogen B.cinerea (PubMed:17059405, PubMed:21990940). Regulates the antagonistic relationship between defense pathways mediating responses to the bacterial pathogen P. syringae and the necrotrophic pathogen B.cinerea (PubMed:17059405). Required for the phytoalexin camalexin synthesis following infection with B.cinerea. Acts as positive regulator of the camalexin biosynthetic genes PAD3 (CYP71B15) and CYP71A13 by binding to their promoters (PubMed:21498677, PubMed:22392279). Acts downstream of MPK3 and MPK6 in reprogramming the expression of camalexin biosynthetic genes, which drives the metabolic flow to camalexin production (PubMed:21498677). Functions with WRKY25 as positive regulator of salt stress response and abscisic acid (ABA) signaling (PubMed:18839316). Functions with WRKY25 and WRKY26 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). The DNA-binding activity of WRKY33 is increased by SIB1 and SIB2 (PubMed:21990940). {ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:21336597, ECO:0000269|PubMed:21498677, ECO:0000269|PubMed:21990940, ECO:0000269|PubMed:22392279}. |
| UniProt | Transcription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: By salt stress (PubMed:18839316). Induced by infection with the necrotrophic fungal pathogen B.cinerea (PubMed:17059405, PubMed:21498677, PubMed:21990940). Induced by infection with the bacterial pathogen P.syringae pv. tomato DC3000 (PubMed:17059405). {ECO:0000269|PubMed:17059405, ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:21498677, ECO:0000269|PubMed:21990940}. |
| UniProt | INDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:15618416, PubMed:19199048). Slightly down-regulated by gibberellic acid (GA) (PubMed:15618416). Accumulates in response to jasmonic acid (MeJA) (By similarity). {ECO:0000250|UniProtKB:Q6B6R4, ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048}. |
| UniProt | INDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}. |
| Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science, 2003. 301(5631): p. 376-9
[PMID:12869764] - Zhang ZL, et al.
A negative regulator encoded by a rice WRKY gene represses both abscisic acid and gibberellins signaling in aleurone cells.
Plant Mol. Biol., 2009. 70(1-2): p. 139-51
[PMID:19199048] - Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
Plant Methods, 2010. 6: p. 25
[PMID:21108821] - Brand LH, et al.
Screening for protein-DNA interactions by automatable DNA-protein interaction ELISA.
PLoS ONE, 2013. 8(10): p. e75177
[PMID:24146751] - Ali MA,Wieczorek K,Kreil DP,Bohlmann H
The beet cyst nematode Heterodera schachtii modulates the expression of WRKY transcription factors in syncytia to favour its development in Arabidopsis roots.
PLoS ONE, 2014. 9(7): p. e102360
[PMID:25033038] - Basu S,Roychoudhury A
Expression profiling of abiotic stress-inducible genes in response to multiple stresses in rice (Oryza sativa L.) varieties with contrasting level of stress tolerance.
Biomed Res Int, 2014. 2014: p. 706890
[PMID:25110688] - Divi UK,Rahman T,Krishna P
Gene expression and functional analyses in brassinosteroid-mediated stress tolerance.
Plant Biotechnol. J., 2016. 14(1): p. 419-32
[PMID:25973891] - Zhang L, et al.
Three WRKY transcription factors additively repress abscisic acid and gibberellin signaling in aleurone cells.
Plant Sci., 2015. 236: p. 214-22
[PMID:26025535] - Peskan-Berghöfer T, et al.
Sustained exposure to abscisic acid enhances the colonization potential of the mutualist fungus Piriformospora indica on Arabidopsis thaliana roots.
New Phytol., 2015. 208(3): p. 873-86
[PMID:26075497] - Wang C, et al.
The Arabidopsis Mediator Complex Subunit16 Is a Key Component of Basal Resistance against the Necrotrophic Fungal Pathogen Sclerotinia sclerotiorum.
Plant Physiol., 2015. 169(1): p. 856-72
[PMID:26143252] - Wang C, et al.
Arabidopsis Elongator subunit 2 positively contributes to resistance to the necrotrophic fungal pathogens Botrytis cinerea and Alternaria brassicicola.
Plant J., 2015. 83(6): p. 1019-33
[PMID:26216741] - Datta R, et al.
Glutathione Regulates 1-Aminocyclopropane-1-Carboxylate Synthase Transcription via WRKY33 and 1-Aminocyclopropane-1-Carboxylate Oxidase by Modulating Messenger RNA Stability to Induce Ethylene Synthesis during Stress.
Plant Physiol., 2015. 169(4): p. 2963-81
[PMID:26463088] - Daumann M,Fischer M,Niopek-Witz S,Girke C,Möhlmann T
Apoplastic Nucleoside Accumulation in Arabidopsis Leads to Reduced Photosynthetic Performance and Increased Susceptibility Against Botrytis cinerea.
Front Plant Sci, 2015. 6: p. 1158
[PMID:26779190] - Liu S,Bartnikas LM,Volko SM,Ausubel FM,Tang D
Mutation of the Glucosinolate Biosynthesis Enzyme Cytochrome P450 83A1 Monooxygenase Increases Camalexin Accumulation and Powdery Mildew Resistance.
Front Plant Sci, 2016. 7: p. 227
[PMID:26973671] - Jiang Y,Yu D
The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance.
Plant Physiol., 2016. 171(4): p. 2771-82
[PMID:27268959] - Liao CJ,Lai Z,Lee S,Yun DJ,Mengiste T
Arabidopsis HOOKLESS1 Regulates Responses to Pathogens and Abscisic Acid through Interaction with MED18 and Acetylation of WRKY33 and ABI5 Chromatin.
Plant Cell, 2016. 28(7): p. 1662-81
[PMID:27317674] - Birkenbihl RP,Kracher B,Roccaro M,Somssich IE
Induced Genome-Wide Binding of Three Arabidopsis WRKY Transcription Factors during Early MAMP-Triggered Immunity.
Plant Cell, 2017. 29(1): p. 20-38
[PMID:28011690] - Nguyen CC, et al.
Overexpression of oligouridylate binding protein 1b results in ABA hypersensitivity.
Plant Signal Behav, 2017. 12(2): p. e1282591
[PMID:28112571] - Liu S,Ziegler J,Zeier J,Birkenbihl RP,Somssich IE
Botrytis cinerea B05.10 promotes disease development in Arabidopsis by suppressing WRKY33-mediated host immunity.
Plant Cell Environ., 2017. 40(10): p. 2189-2206
[PMID:28708934] - D'Ambrosio JM, et al.
Phospholipase C2 Affects MAMP-Triggered Immunity by Modulating ROS Production.
Plant Physiol., 2017. 175(2): p. 970-981
[PMID:28827453] - Liu F, et al.
Interactions of WRKY15 and WRKY33 transcription factors and their roles in the resistance of oilseed rape to Sclerotinia infection.
Plant Biotechnol. J., 2018. 16(4): p. 911-925
[PMID:28929638] - Crespo-Salvador Ó,Escamilla-Aguilar M,López-Cruz J,López-Rodas G,González-Bosch C
Determination of histone epigenetic marks in Arabidopsis and tomato genes in the early response to Botrytis cinerea.
Plant Cell Rep., 2018. 37(1): p. 153-166
[PMID:29119291]
|
