PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sme2.5_02389.1_g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 134aa MW: 15745.6 Da PI: 10.1255 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 104.5 | 5.6e-33 | 47 | 105 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk++++prsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H+h+ Sme2.5_02389.1_g00002.1 47 LDDGYRWRKYGQKAVKNNNYPRSYYRCTHEGCNVKKQVQRLSKDEGVVVTTYEGMHTHP 105 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 4.5E-35 | 32 | 105 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 5.1E-30 | 39 | 106 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.998 | 42 | 107 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.5E-39 | 47 | 106 | IPR003657 | WRKY domain |
Pfam | PF03106 | 5.3E-27 | 48 | 105 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006817 | Biological Process | phosphate ion transport | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008134 | Molecular Function | transcription factor binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
MYNSTSSSSQ MHTSENHNNF SVKKKGDNKK MKKPRFAFQT RSQVDILDDG YRWRKYGQKA 60 VKNNNYPRSY YRCTHEGCNV KKQVQRLSKD EGVVVTTYEG MHTHPIDKPN DNFEQILHQM 120 HIFPQSSPFV NSQI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 6e-29 | 37 | 106 | 7 | 76 | Probable WRKY transcription factor 4 |
2lex_A | 6e-29 | 37 | 106 | 7 | 76 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00325 | DAP | Transfer from AT3G01970 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975514 | 9e-57 | HG975514.1 Solanum lycopersicum chromosome ch02, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015065534.1 | 8e-68 | probable WRKY transcription factor 45 | ||||
Refseq | XP_016562331.1 | 1e-67 | PREDICTED: probable WRKY transcription factor 43 | ||||
Swissprot | Q9S763 | 4e-51 | WRK45_ARATH; Probable WRKY transcription factor 45 | ||||
TrEMBL | A0A2G2XJ03 | 2e-66 | A0A2G2XJ03_CAPBA; Putative WRKY transcription factor 56 | ||||
TrEMBL | A0A2G3DA69 | 2e-66 | A0A2G3DA69_CAPCH; Putative WRKY transcription factor 56 | ||||
STRING | PGSC0003DMT400052057 | 7e-67 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2204 | 24 | 61 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01970.1 | 8e-53 | WRKY DNA-binding protein 45 |
Publications ? help Back to Top | |||
---|---|---|---|
|