PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc10g047060.1.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 213aa MW: 24645.2 Da PI: 6.1721 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 116.3 | 3.1e-36 | 20 | 139 | 1 | 127 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 lppGf F P+deel+v++L++k++ +++ +vi+++++++++PwdL+ k+ ++ ++wyf+s+r + +++r+t++gyWk+ g d++ Solyc10g047060.1.1 20 LPPGFWFCPSDEELIVHFLHRKISLLPFHP-DVIPDLHLHSYDPWDLDGKAMSGGNKWYFYSRRTH------ETTRITSNGYWKSLGVDET 103 79*************************999.99**************977778899******9977......5789*************** PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyr 127 +ls+++++ g+kk +fy g+ p+g+kt+W+m+ey+ Solyc10g047060.1.1 104 ILSTSNHNLGMKKYYTFYMGQPPQGHKTNWLMQEYS 139 ***********************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.18E-45 | 15 | 179 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 41.832 | 20 | 180 | IPR003441 | NAC domain |
Pfam | PF02365 | 7.0E-20 | 21 | 139 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 213 aa Download sequence Send to blast |
MGDNNNNNNN NNNNNNHVKL PPGFWFCPSD EELIVHFLHR KISLLPFHPD VIPDLHLHSY 60 DPWDLDGKAM SGGNKWYFYS RRTHETTRIT SNGYWKSLGV DETILSTSNH NLGMKKYYTF 120 YMGQPPQGHK TNWLMQEYSH ISHSSPSSSS SRRRRSESKI VCPLSFHDYS KWVICRVYES 180 NSCDSDENEL SCLDEVFLSL DDLDDDEISL PH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 2e-36 | 16 | 182 | 16 | 170 | NAC domain-containing protein 19 |
3swm_B | 2e-36 | 16 | 182 | 16 | 170 | NAC domain-containing protein 19 |
3swm_C | 2e-36 | 16 | 182 | 16 | 170 | NAC domain-containing protein 19 |
3swm_D | 2e-36 | 16 | 182 | 16 | 170 | NAC domain-containing protein 19 |
3swp_A | 2e-36 | 16 | 182 | 16 | 170 | NAC domain-containing protein 19 |
3swp_B | 2e-36 | 16 | 182 | 16 | 170 | NAC domain-containing protein 19 |
3swp_C | 2e-36 | 16 | 182 | 16 | 170 | NAC domain-containing protein 19 |
3swp_D | 2e-36 | 16 | 182 | 16 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in root xylem vessels (PubMed:15923329). Expressed in stems, vascular tissue of cauline leaves and tracheary elements of sepals (PubMed:18069942). {ECO:0000269|PubMed:15923329, ECO:0000269|PubMed:18069942}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc10g047060.1.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004248807.2 | 1e-114 | NAC domain-containing protein 104-like | ||||
Swissprot | Q8GWK6 | 5e-68 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A3Q7IER4 | 1e-155 | A0A3Q7IER4_SOLLC; Uncharacterized protein | ||||
STRING | Solyc10g047060.1.1 | 1e-156 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3766 | 24 | 47 | Representative plant | OGRP4510 | 10 | 24 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 3e-57 | xylem NAC domain 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc10g047060.1.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|