PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc10g017640.1.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 62aa MW: 7032.22 Da PI: 11.236 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91.8 | 3.3e-29 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien + rqvtfskRrng+lKKA+ELSvLCda+v ++i+s+++klye+s+ Solyc10g017640.1.1 10 RIENATSRQVTFSKRRNGLLKKAFELSVLCDAQVGLVILSPRDKLYEFST 59 8***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.969 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.3E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.22E-34 | 3 | 60 | No hit | No description |
PRINTS | PR00404 | 1.5E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.44E-27 | 3 | 60 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.5E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 62 aa Download sequence Send to blast |
MVRGKTEMRR IENATSRQVT FSKRRNGLLK KAFELSVLCD AQVGLVILSP RDKLYEFSTS 60 R* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in the outer layers of the root meristem (lateral root cap and epidermis) and in the central cylinder cells of mature roots. Also present in rosette leaves and seedlings and, to a lesser extent, in cauline leaves and flowers. Enriched in apices including the shoot apical meristem and developing leaf primordia. {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:16778081}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269|PubMed:16778081}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc10g017640.1.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269|PubMed:16778081}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004248574.1 | 6e-36 | MADS-box protein SOC1-like isoform X1 | ||||
Refseq | XP_025883671.1 | 6e-36 | MADS-box protein SOC1-like isoform X1 | ||||
Refseq | XP_025883672.1 | 5e-36 | MADS-box protein SOC1-like isoform X2 | ||||
Swissprot | O82743 | 2e-32 | AGL19_ARATH; Agamous-like MADS-box protein AGL19 | ||||
TrEMBL | A0A3Q7IDM6 | 1e-34 | A0A3Q7IDM6_SOLLC; Uncharacterized protein | ||||
STRING | Solyc10g017640.1.1 | 4e-37 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G22950.1 | 7e-35 | AGAMOUS-like 19 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc10g017640.1.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|