PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g061130.2.1
Common NameHY5
Organism
Solanum lycopersicum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 159aa    MW: 17341.2 Da    PI: 10.4138
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g061130.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.21e-1484144161
                         XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                         +ke kr +r+ +NR++A+  R+RKka++  Le +vkeLe++N +L ++l++l++e + l+ 
  Solyc08g061130.2.1  84 DKENKRLKRLLRNRVSAQQARERKKAYLIDLEARVKELETKNAELEERLSTLQNENQMLRH 144
                         5899****************************************************98865 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-1484148IPR004827Basic-leucine zipper domain
PfamPF001706.8E-1485145IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.46186149IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.13E-1388146No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-1688148No hitNo description
CDDcd147044.76E-1689140No hitNo description
PROSITE patternPS00036091106IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009585Biological Processred, far-red light phototransduction
GO:0009737Biological Processresponse to abscisic acid
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0010224Biological Processresponse to UV-B
GO:0031539Biological Processpositive regulation of anthocyanin metabolic process
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003690Molecular Functiondouble-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MQEQATSSIA ASSLPSSSER SSSSALHHEL KEGMESDDEI RRVPEMGGEA TGTTSASGRD  60
GVSAAGQAQP SAGTQRKRGR SPADKENKRL KRLLRNRVSA QQARERKKAY LIDLEARVKE  120
LETKNAELEE RLSTLQNENQ MLRHILKNTT AGAQEGRK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_A7e-16109148342Transcription factor HY5
2oqq_B7e-16109148342Transcription factor HY5
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.35430.0flower| fruit| leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}.
Function -- GeneRIF ? help Back to Top
  1. Through binding to the promoter of ABI5, HY5 triggers enhanced photoprotection through induction of an apoplastic H2O2 burst that influences antioxidant status, cyclic electron flux(CEF), and nonphotochemical quenching(NPQ). This enhanced photoprotection allows shade leaves to avoid photoinhibition. [HY5]
    [PMID: 29146776]
  2. mediates CRY1a-induced anthocyanin biosynthesis
    [PMID: 29566255]
  3. Long hypocotyl 5 protein inhibits tomato growth and induces cold tolerance by integrating both light and temperature signaling.
    [PMID: 30563923]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00117ampDAPTransfer from AT5G11260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc08g061130.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0119140.0Solanum lycopersicum mRNA for THY5 protein
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234820.11e-109transcription factor HY5
SwissprotQ9SM501e-110HY5_SOLLC; Transcription factor HY5
TrEMBLA0A0V0HHN31e-105A0A0V0HHN3_SOLCH; Putative transcription factor HY5-like
STRINGSolyc08g061130.2.11e-108(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA80372430
Representative plantOGRP20811737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.12e-43bZIP family protein
Publications ? help Back to Top
  1. Liu Y, et al.
    Manipulation of light signal transduction as a means of modifying fruit nutritional quality in tomato.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(26): p. 9897-902
    [PMID:15178762]
  2. Wang F, et al.
    Light Signaling-Dependent Regulation of Photoinhibition and Photoprotection in Tomato.
    Plant Physiol., 2018. 176(2): p. 1311-1326
    [PMID:29146776]
  3. Liu CC, et al.
    The bZip transcription factor HY5 mediates CRY1a-induced anthocyanin biosynthesis in tomato.
    Plant Cell Environ., 2018. 41(8): p. 1762-1775
    [PMID:29566255]
  4. Wang F, et al.
    SlHY5 Integrates Temperature, Light, and Hormone Signaling to Balance Plant Growth and Cold Tolerance.
    Plant Physiol., 2019. 179(2): p. 749-760
    [PMID:30563923]