PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g051060.2.1
Organism
Solanum lycopersicum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 285aa    MW: 32151.8 Da    PI: 8.4661
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g051060.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.52.7e-32113166255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Solyc05g051060.2.1 113 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 166
                         9****************************************************7 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-15110166IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28111166IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-23113166IPR006447Myb domain, plants
PfamPF002491.3E-7114165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MNSYHGVSLL DPIKGIPIYH HHQDPKRSSS FGSIYHNNLD HISYSNNSYV TNVASSSPYN  60
RIPIVANRFQ NQQHIYYNGV GLLGSPSSHE SNNFLMRSRF LPKFPTKRSM RAPRMRWTTS  120
LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH LQMYRTVKTT DKPAASSDGS  180
GEEDLLAIDK ILDQRGPLDG CDEPSTTLWS NSSSSRERLS QANFNESNGL IRSSSFPSQQ  240
RFSHHIEECE YSRAMSYVGC SLDQKNPSLE FTLGRSDWVE KNHD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-17114168458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-17114168458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-17114168357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-17114168357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-17114168357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-17114168357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-17114168458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-17114168458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-17114168458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-17114168458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-17114168458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-17114168458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In globular embryos, expressed in the peripheral cells in a basal region above the hypophysis. In heart-stage embryos, expressed in the periphery of the presumptive hypocotyl and on the abaxial side of cotyledon primordia. During vegetative growth, expressed the abaxial side of very young leaf primordia. Expressed on the abaxial side of carpel primordia and then in a localized region on the abaxial margin that gives rise to the septum. Later, expressed in the tissue that gives rise to ovules. {ECO:0000269|PubMed:11525739}.
UniprotTISSUE SPECIFICITY: Expressed in developing phloem and lateral root. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269|PubMed:11395775, ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928, ECO:0000269|PubMed:18849474, ECO:0000269|PubMed:20179097}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g051060.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269|PubMed:18849474}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2395830.0Solanum lycopersicum chromosome 5 clone C05HBa0201O22, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240040.10.0transcription repressor KAN1-like isoform X1
SwissprotQ93WJ92e-68KAN1_ARATH; Transcription repressor KAN1
TrEMBLA0A3Q7GNA50.0A0A3Q7GNA5_SOLLC; Uncharacterized protein
STRINGSolyc05g051060.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-65G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Huang T,Kerstetter RA,Irish VF
    APUM23, a PUF family protein, functions in leaf development and organ polarity in Arabidopsis.
    J. Exp. Bot., 2014. 65(4): p. 1181-91
    [PMID:24449383]
  4. Mach J
    Getting in Shape? Leaves work it out with KANADI1.
    Plant Cell, 2014. 26(1): p. 4
    [PMID:24464293]
  5. Jun SE, et al.
    Comparative analysis of the conserved functions of Arabidopsis DRL1 and yeast KTI12.
    Mol. Cells, 2015. 38(3): p. 243-50
    [PMID:25518926]
  6. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  7. Xie Y, et al.
    Meta-Analysis of Arabidopsis KANADI1 Direct Target Genes Identifies a Basic Growth-Promoting Module Acting Upstream of Hormonal Signaling Pathways.
    Plant Physiol., 2015. 169(2): p. 1240-53
    [PMID:26246448]
  8. Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL
    Active suppression of a leaf meristem orchestrates determinate leaf growth.
    Elife, 2017.
    [PMID:27710768]
  9. Singh A, et al.
    Phytohormonal crosstalk modulates the expression of miR166/165s, target Class III HD-ZIPs, and KANADI genes during root growth in Arabidopsis thaliana.
    Sci Rep, 2017. 7(1): p. 3408
    [PMID:28611467]
  10. Caggiano MP, et al.
    Cell type boundaries organize plant development.
    Elife, 2018.
    [PMID:28895530]
  11. Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F
    Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers.
    Development, 2018.
    [PMID:29361563]