PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc03g033680.1.1 | ||||||||
Common Name | LOC101267013, SlEOT2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 117aa MW: 12294.2 Da PI: 4.0917 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 48.6 | 2.8e-15 | 1 | 35 | 120 | 154 |
DUF702 120 vssvddgeeelaYqtavsigGhvfkGiLydqGlee 154 +ss++++e+++aYq+av+i+Gh+fkGiLydqG ++ Solyc03g033680.1.1 1 MSSIEENEDQIAYQAAVNINGHIFKGILYDQGDNH 35 689*****************************886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 1.8E-12 | 1 | 34 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01624 | 3.5E-16 | 1 | 32 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MSSIEENEDQ IAYQAAVNIN GHIFKGILYD QGDNHEYNYM NGGDYDSSSG GDPVPRQYNL 60 NITRTATSAA NDVAVGGGGV ASAMAAEGSS HFLETSLYSS VNTFVAGTQF FPPSRS* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator involved in the transcriptional regulation of terpene biosynthesis in glandular trichomes (PubMed:24884371, PubMed:24142382). Binds to the promoter of the linalool synthase TPS5 and promotes TPS5 gene transactivation (PubMed:24884371, PubMed:24142382). Acts synergistically with MYC1 in the transactivation of TPS5 (PubMed:24884371). {ECO:0000269|PubMed:24142382, ECO:0000269|PubMed:24884371}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc03g033680.1.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001316391.1 | 1e-79 | transcription factor EXPRESSION OF TERPENOIDS 2 | ||||
Swissprot | K4B6C9 | 7e-23 | EOT1_SOLLC; Protein EXPRESSION OF TERPENOIDS 1 | ||||
TrEMBL | A0A3Q7FFT4 | 4e-79 | A0A3Q7FFT4_SOLLC; Uncharacterized protein | ||||
TrEMBL | U5L363 | 2e-78 | U5L363_SOLLC; Expression of terpenoids 2 | ||||
STRING | Solyc03g033680.1.1 | 6e-80 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA17600 | 4 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G75520.1 | 2e-13 | SHI-related sequence 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc03g033680.1.1 |
Entrez Gene | 101245925 | 101267013 |
Publications ? help Back to Top | |||
---|---|---|---|
|