PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Seita.7G104000.1.p | ||||||||
Common Name | LOC101774132, SETIT_011079mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 201aa MW: 22467.9 Da PI: 5.0434 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 102.8 | 4.4e-32 | 7 | 124 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 lppGf+F P+deel+v++L++k++ +++ +++++v +++++Pw+L+ k+ + ++wyfFs++ ++r+t +gyW++ d+ Seita.7G104000.1.p 7 LPPGFHFFPSDEELIVHFLRRKASMLPCQP-DIVPTVLLNHYNPWELNDKALQAGNRWYFFSHAT--------QSRVTPNGYWSSICADEI 88 79*************************999.99**************966666789******975........5799*********99887 PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 v s +g +vglkktL+f g+ ++g +t+W+mhey+l Seita.7G104000.1.p 89 VES-GGCNVGLKKTLIFSIGEPSEGIETNWIMHEYHL 124 777.9******************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.83E-42 | 4 | 162 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 38.879 | 7 | 164 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.2E-21 | 8 | 124 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0043067 | Biological Process | regulation of programmed cell death | ||||
GO:0048367 | Biological Process | shoot system development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 201 aa Download sequence Send to blast |
MGGSSDLPPG FHFFPSDEEL IVHFLRRKAS MLPCQPDIVP TVLLNHYNPW ELNDKALQAG 60 NRWYFFSHAT QSRVTPNGYW SSICADEIVE SGGCNVGLKK TLIFSIGEPS EGIETNWIMH 120 EYHLLDGRKG SGSSTSTSSS RKLHRNKSHS NTESNWVICR VFDSTCGSQV NYHEEGMELS 180 CLDEVFLSLD DYDEVSLSNN * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-35 | 7 | 169 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-35 | 7 | 169 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-35 | 7 | 169 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-35 | 7 | 169 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-35 | 7 | 169 | 20 | 173 | NAC domain-containing protein 19 |
3swm_B | 5e-35 | 7 | 169 | 20 | 173 | NAC domain-containing protein 19 |
3swm_C | 5e-35 | 7 | 169 | 20 | 173 | NAC domain-containing protein 19 |
3swm_D | 5e-35 | 7 | 169 | 20 | 173 | NAC domain-containing protein 19 |
3swp_A | 5e-35 | 7 | 169 | 20 | 173 | NAC domain-containing protein 19 |
3swp_B | 5e-35 | 7 | 169 | 20 | 173 | NAC domain-containing protein 19 |
3swp_C | 5e-35 | 7 | 169 | 20 | 173 | NAC domain-containing protein 19 |
3swp_D | 5e-35 | 7 | 169 | 20 | 173 | NAC domain-containing protein 19 |
4dul_A | 5e-35 | 7 | 169 | 17 | 170 | NAC domain-containing protein 19 |
4dul_B | 5e-35 | 7 | 169 | 17 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Seita.7G104000.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004975667.1 | 1e-149 | NAC domain-containing protein 104 | ||||
Swissprot | Q8GWK6 | 1e-60 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | K3YA37 | 1e-147 | K3YA37_SETIT; Uncharacterized protein | ||||
STRING | Si011079m | 1e-148 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3667 | 36 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 1e-61 | xylem NAC domain 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Seita.7G104000.1.p |
Entrez Gene | 101774132 |
Publications ? help Back to Top | |||
---|---|---|---|
|