PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G040100.1.p
Common NameLOC101783358, SETIT_005753mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family ARF
Protein Properties Length: 1055aa    MW: 116392 Da    PI: 6.5387
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G040100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B370.71.9e-22127227198
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f+k+lt sd++++g +++p++ ae++       ++++++  +l+ +d++  sW++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F +
  Seita.4G040100.1.p 127 FCKTLTASDTSTHGGFSVPRRAAEKIfppldftMQPPAQ--ELIAKDLHDISWKFRHIYRGQPKRHLLTTGWSVFVSTKRLLAGDSVLFIR 215
                         99*****************************96555444..8************************************************4 PP

                         -SSSEE..EEEEE- CS
                  B3  85 dgrsefelvvkvfr 98 
                           +++ +l+++++ 
  Seita.4G040100.1.p 216 --DEKSQLLLGIRH 227
                         ..566667888876 PP

2Auxin_resp122.92.3e-40253335183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aahaa+++s+F+++YnPras+seFv++++k++kal+++vs+GmRf+m feteds  rr++Gt++g+ dldp+rW+nS+Wr+L+
  Seita.4G040100.1.p 253 AAHAAANSSPFTIFYNPRASPSEFVIPLAKYNKALYTQVSLGMRFRMLFETEDSGVRRYMGTITGIGDLDPIRWKNSHWRNLQ 335
                         79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.09E-44117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.5E-40119242IPR015300DNA-binding pseudobarrel domain
CDDcd100172.13E-19126226No hitNo description
SMARTSM010191.4E-22127229IPR003340B3 DNA binding domain
PfamPF023621.8E-20127227IPR003340B3 DNA binding domain
PROSITE profilePS5086311.97127229IPR003340B3 DNA binding domain
PfamPF065074.1E-35253335IPR010525Auxin response factor
PfamPF023092.4E-99361025IPR033389AUX/IAA domain
PROSITE profilePS5174525.7479391032IPR000270PB1 domain
SuperFamilySSF542771.08E-89551018No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1055 aa     Download sequence    Send to blast
MKDPGSGGVT PSPAEGDKKP INSELWHACA GPLVSLPPVG SLVVYFPQGH SEQVAASMHK  60
ELDTIPSYPS LPSKLICKLL SLTLHADSET DEVYAQMTLQ PVNKYDRDAM LASELGLKQN  120
KQPTEFFCKT LTASDTSTHG GFSVPRRAAE KIFPPLDFTM QPPAQELIAK DLHDISWKFR  180
HIYRGQPKRH LLTTGWSVFV STKRLLAGDS VLFIRDEKSQ LLLGIRHASR PQPALSSSVL  240
SSDSMHIGIL AAAAHAAANS SPFTIFYNPR ASPSEFVIPL AKYNKALYTQ VSLGMRFRML  300
FETEDSGVRR YMGTITGIGD LDPIRWKNSH WRNLQVGWDE STASERRTRV SIWEIEPVAT  360
PFYICPPPFF RPKLPKQPGM PDDENEVESA FKRAMPWLGD DFALKDVQNA LFPGLSLVQW  420
MAMQQNPQML TAAAPAVQSQ YLTSNALGMQ DGIGGVNEDP AKRLSMQAQN IGLPNLQAGS  480
KVDHPAITSL AQQQQQQHPI LQQQQVQPLQ QNSAILQQQQ AQLLQQNAIH LQQQQEQLQR  540
QHSQPPQQLK ATASLQPMDQ HKLKEQQPSG GQAVSQAQLL NQILQPSSSQ IQQLGLPKSP  600
TQRPGLPGLT TMGSLPQPQL TQTPQLQQTA EYQQALLQSQ QPQLQQLSQS ELQLQLLQKI  660
QQQNLLSQLN PQHQSQLIQQ LSQKSQEILQ QQVLQHQLGG ADTMGQLKHL QQTPLNHMTG  720
SMTPQQLVRS HSALAESEEP SSSTAPSGSR VSPINSLSRA QQGSRNLPEI PSTPHIEHLL  780
QEIQSKSDNR IKNDIQGSKE TVHAPNRHPA SDQLDASSAT SFCLDESPRE GFSFPPVCLD  840
STAQVDPRDN FLIAENVDTL MPDALLSRGM SSGKGICNLP TGQRDHRDVE NELSSAAFSS  900
QSFGVPDMSF KPGCSSDVAV ADGGMASQGL WNSQTQRMRT FTKVQKRGSV GRSIDITRYR  960
GYEDLRHDLA CMFGIQGQLE DPYRTDWKLV YVDHENDILL VGDDPWEEFV SCVKSIKILS  1020
SAEVQQMSLD GDLGCIPPQG QACSASDDAN AWRG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1651635645388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.4G040100.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under dark condition. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277410.0KJ727741.1 Zea mays clone pUT5682 ARF transcription factor (ARF27) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964586.10.0auxin response factor 16 isoform X1
SwissprotA3B9A00.0ARFP_ORYSJ; Auxin response factor 16
TrEMBLK3XUZ60.0K3XUZ6_SETIT; Auxin response factor
STRINGSi005753m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90453338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Shen C, et al.
    OsARF16, a transcription factor, is required for auxin and phosphate starvation response in rice (Oryza sativa L.).
    Plant Cell Environ., 2013. 36(3): p. 607-20
    [PMID:22913536]
  2. Shen C, et al.
    OsARF16 is involved in cytokinin-mediated inhibition of phosphate transport and phosphate signaling in rice (Oryza sativa L.).
    PLoS ONE, 2014. 9(11): p. e112906
    [PMID:25386911]
  3. Shen C, et al.
    OsARF16, a transcription factor regulating auxin redistribution, is required for iron deficiency response in rice (Oryza sativa L.).
    Plant Sci., 2015. 231: p. 148-58
    [PMID:25576000]