PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Seita.3G225500.1.p | ||||||||
Common Name | LOC101784952, SETIT_023363mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 188aa MW: 20730 Da PI: 9.4119 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46.2 | 1e-14 | 119 | 163 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++++ +++G g+W+ I+r k+Rt+ q+ s+ qky Seita.3G225500.1.p 119 PWTEEEHRLFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKY 163 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 7.062 | 22 | 76 | IPR017877 | Myb-like domain |
SuperFamily | SSF46689 | 1.59E-11 | 24 | 77 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 0.0081 | 26 | 78 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.0E-6 | 27 | 76 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 20.291 | 112 | 168 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.35E-18 | 114 | 168 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.2E-11 | 116 | 166 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 3.7E-17 | 116 | 167 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.5E-11 | 118 | 162 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.3E-11 | 119 | 163 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.65E-11 | 119 | 164 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
MAFYYGVSGQ SSSPAAAAWG APPTPSSRPW TKAEDKVFEG ALVTFPEHVP NRWVLVASQL 60 PGRTAQEAWD HYQALLTDVD LIERGMVEAP GSWDHDDAAA GRGRGRGAGS GDERRRGVPW 120 TEEEHRLFLE GLEKYGRGDW RNISRWSVKT RTPTQVASHA QKYFIRQASA GSRGDTKRKS 180 IHDITTP* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Seita.3G225500.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK367954 | 1e-138 | AK367954.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2065H11. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004961933.1 | 1e-135 | transcription factor DIVARICATA | ||||
Swissprot | Q8S9H7 | 3e-51 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | K3Z9Z2 | 1e-133 | K3Z9Z2_SETIT; Uncharacterized protein | ||||
STRING | Si023363m | 1e-134 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2895 | 36 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G58900.1 | 6e-45 | Homeodomain-like transcriptional regulator |
Link Out ? help Back to Top | |
---|---|
Phytozome | Seita.3G225500.1.p |
Entrez Gene | 101784952 |
Publications ? help Back to Top | |||
---|---|---|---|
|