PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Seita.3G108500.1.p | ||||||||
Common Name | LOC101778621, SETIT_023279mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 204aa MW: 21669.6 Da PI: 6.5161 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 97 | 1.3e-30 | 108 | 166 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K vk+s++pr+YYrC+s+gC vkk+ver+++dp++v++tY g Hnh Seita.3G108500.1.p 108 LDDGFKWRKYGKKAVKNSPNPRNYYRCSSEGCGVKKRVERDRDDPRYVITTYDGVHNHA 166 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 7.3E-33 | 96 | 168 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.67E-28 | 100 | 168 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.996 | 103 | 168 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.2E-35 | 108 | 167 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.7E-24 | 109 | 165 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
MAASLGLNPE ALFSSFSSSY YSPFMSDYAP SFPAASNAVD DAAAFSAELD DLCRFEYSPA 60 APVFASAGGG AGGDDRNDKS MSCEGGDEKR PRSNGRIGFR TRSEVEILDD GFKWRKYGKK 120 AVKNSPNPRN YYRCSSEGCG VKKRVERDRD DPRYVITTYD GVHNHASPTA AAAIQYGSGG 180 GGFYSPPSSG SPSAASYSGS YLF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-28 | 93 | 168 | 2 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 4e-28 | 93 | 168 | 2 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Seita.3G108500.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KU058609 | 1e-143 | KU058609.1 UNVERIFIED: Panicum miliaceum WRKY15-like gene, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004960874.1 | 1e-145 | probable WRKY transcription factor 51 | ||||
Swissprot | Q8VWQ5 | 4e-41 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | K3Z9Q8 | 1e-144 | K3Z9Q8_SETIT; Uncharacterized protein | ||||
STRING | Si023279m | 1e-144 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 4e-41 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Seita.3G108500.1.p |
Entrez Gene | 101778621 |
Publications ? help Back to Top | |||
---|---|---|---|
|