PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G028100.3.p
Common NameLOC101781038, SETIT_021121mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family ARF
Protein Properties Length: 938aa    MW: 103131 Da    PI: 6.149
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G028100.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.41.4e-23143244199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k lt sd++++g +++p++ ae+       ++++++ ++l+++d++ + W++++iyr++++r++lt+GW+ Fv a++Lk+gD+v+F   
  Seita.3G028100.3.p 143 FCKNLTASDTSTHGGFSVPRRAAEKLfpqldySMQPPN-QELIVRDLHDNLWTFRHIYRGQPKRHLLTTGWSLFVGAKRLKAGDSVLFI-- 230
                         89*********************999*****9555555.49************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         ++++ +l+v+v+r+
  Seita.3G028100.3.p 231 RDEKSQLLVGVRRA 244
                         4577778*****97 PP

2Auxin_resp109.53.5e-36269351183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aahaas++  F+++YnPr+s+s Fv+++++++ka++++ svGmRf  +fete+ss+rr++Gtvvg+sd+dp+rWpnSkWr+L+
  Seita.3G028100.3.p 269 AAHAASSGGSFTIYYNPRTSPSPFVIPLARYNKATYMQPSVGMRFATMFETEESSKRRCTGTVVGISDYDPMRWPNSKWRNLQ 351
                         79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.03E-44133272IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.4E-40136257IPR015300DNA-binding pseudobarrel domain
CDDcd100173.42E-21142243No hitNo description
SMARTSM010199.6E-23143245IPR003340B3 DNA binding domain
PROSITE profilePS5086312.689143245IPR003340B3 DNA binding domain
PfamPF023623.8E-21143244IPR003340B3 DNA binding domain
PfamPF065071.9E-31269351IPR010525Auxin response factor
PROSITE profilePS5174523.737833917IPR000270PB1 domain
PfamPF023091.0E-8837920IPR033389AUX/IAA domain
SuperFamilySSF542775.17E-8852912No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009908Biological Processflower development
GO:0009942Biological Processlongitudinal axis specification
GO:0010305Biological Processleaf vascular tissue pattern formation
GO:0048364Biological Processroot development
GO:0048507Biological Processmeristem development
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
GO:0042802Molecular Functionidentical protein binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 938 aa     Download sequence    Send to blast
MASSQEKATS GVLRNAAALL DEMQLMGETQ GAKKVINSEL WHACAGPLVC LPQRGSLVYY  60
FPQGHSEQVA ATTKKVPNSR IPNYPSLPSQ LLCQVHNITL HADKETDEIY AQMTLQPVHS  120
ETEVFPIPSL GAYTKSKHPT EYFCKNLTAS DTSTHGGFSV PRRAAEKLFP QLDYSMQPPN  180
QELIVRDLHD NLWTFRHIYR GQPKRHLLTT GWSLFVGAKR LKAGDSVLFI RDEKSQLLVG  240
VRRATRQQPA LSSSVLSTDS MHIGVLAAAA HAASSGGSFT IYYNPRTSPS PFVIPLARYN  300
KATYMQPSVG MRFATMFETE ESSKRRCTGT VVGISDYDPM RWPNSKWRNL QVEWDEHGYG  360
ERPERVSLWD IETPENSLVF SSPLNSKRQC LPSYGVPGLQ IGSVNMSSIP RAQGNPFGNL  420
QHMPGIGSEL ALMLLNQSGQ NLGSPLACQQ SSFSSIIQNV NHGYIPPSTF GASTGSIKQE  480
SMLSNEAQQQ LSAPNIQKDD QQGIDSTSAQ ELDVRARGPR NTDSYSSQSI SDQNSKGEHR  540
TKTRRSKKGL SHKSISDKSE LSSVPSQICD DQRHGSEPKL VDCETEQVNC GNNEDSSGAL  600
TRGGFAGEPQ VQQVEQHELL APPKFEPSKS PDGGKSVSSF PNQGCSPQFF EGLDWVIQPS  660
YYQDSNGIHS VSASENIFNQ SADITSTINA DTMEAFQNSC LSECFPNSVQ EFISSPDLNS  720
LTFMSPDMQH LDGQHDVNNL PSTSNSYVQM SYSEESGNQS ASLSGLHMEA IHINSSCSEP  780
MTTGSFDAGM FSKLPNLRDS QVLPLQEIHN SSMGTPSCSM DAASVKPIKP PVRTYTKVQK  840
LGSVGRSIDV TRFRDYHELR SAIACMFGLQ GKLEHPGSSD WKLVYVDYEN DVLLVGDDPW  900
EEFINCVRCI RILSPSEVQQ MSENGVHVLN DCIQIAQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A0.01737431390Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00153DAPTransfer from AT1G19850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.3G028100.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012699862.10.0auxin response factor 11 isoform X1
SwissprotQ01K260.0ARFK_ORYSI; Auxin response factor 11
SwissprotQ8S9830.0ARFK_ORYSJ; Auxin response factor 11
TrEMBLK3Z3K30.0K3Z3K3_SETIT; Auxin response factor
STRINGSi021121m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19850.10.0ARF family protein
Publications ? help Back to Top
  1. Shen C, et al.
    Functional analysis of the structural domain of ARF proteins in rice (Oryza sativa L.).
    J. Exp. Bot., 2010. 61(14): p. 3971-81
    [PMID:20693412]
  2. Indoliya Y, et al.
    Decoding regulatory landscape of somatic embryogenesis reveals differential regulatory networks between japonica and indica rice subspecies.
    Sci Rep, 2016. 6: p. 23050
    [PMID:26973288]